KEGG   Corynebacterium diphtheriae HC03: CDHC03_2028Help
Entry
CDHC03_2028       CDS       T01695                                 

Definition
(GenBank) putative zinc-binding alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
cdr  Corynebacterium diphtheriae HC03
Pathway
cdr00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:cdr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CDHC03_2028
Enzymes [BR:cdr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     CDHC03_2028
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     CDHC03_2028
    1.1.1.-  
     CDHC03_2028
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C AdoHcyase_NAD 2-Hacid_dh_C AlaDh_PNT_C NAD_binding_3 ADH_zinc_N_2 Pyr_redox Pyr_redox_2 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AEX79753
Position
complement(2189309..2190400)
Genome map
AA seq 363 aa AA seqDB search
MKAARYYDQKDIRIEEISEQPLLPGTARIKVAWCGICGTDLHEFLEGPLFVPEHHHPHPV
SGEDSPVTLGHEMSGVITEVAEDVTDLAVGDHVVVEPYLIHDDVDTSEANPFYHLSRDMN
FIGLAGGGGGLSENIVVKRRWIHKISPDLPLDEAALIEPLSVGYHAVERAGFASEEAAKG
KVALVGGAGPIGLLTASVLKAFGATVVISELSPLRRKKALDSGAADYALNPAEVDVVEEI
AKLTDGKGADVAFECTSVQVVLDTLMDAVRPGAVIVVVSIWSKRSNFDIHKLVMKEIDLR
GTIAYSHAHPNTIKLVESGKINLKPFITGKIALQDIVDKGFDTLINHNETAVKILVSPSG
AGL
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcacggtactacgaccaaaaagacatccgaattgaagaaatctccgagcag
ccactgctgccaggcactgcccgcatcaaagtagcgtggtgtggcatttgtggcaccgac
ttacacgagttcctcgaaggtccactgttcgtcccagaacaccaccacccgcacccagtt
tccggcgaggactccccagtgaccttggggcatgagatgtccggcgtgatcacagaagtc
gccgaggacgtgaccgatctagccgttggcgaccacgtagtagtagaaccctacttgatt
cacgatgatgtagacacctctgaagccaaccccttctaccatctttcccgcgacatgaac
ttcattggtcttgccggtggcggcggtggcttgagtgaaaacattgtggtcaagcggcgc
tggatccacaaaatctccccagacctgcctctcgacgaagcagccctcatcgaaccactg
tctgtgggctatcacgcagtggaacgtgctgggttcgcctccgaagaagcagccaagggc
aaggttgcacttgtcggcggtgctggacctatcggcttgctcaccgcctcagtactcaag
gctttcggcgccaccgtggtgatatcggaactatccccgctgcgtaggaagaaggcactc
gattccggtgctgccgactacgctctcaacccagcagaagtggatgtggttgaagaaatt
gccaagcttaccgacggcaaaggtgccgacgtcgccttcgaatgcacctccgtccaagta
gtgctggacaccctcatggatgctgttcgcccaggggctgtgatcgttgtggtgtctatc
tggtctaagcgctccaactttgacatccataagttggtgatgaaggagatcgacctgcgc
ggcacgattgcctactcccatgcccacccgaacaccatcaagctggtggaatccggaaag
attaacctcaaaccgtttatcaccggcaagattgcgcttcaagacatcgtggataaaggc
tttgacaccctcattaaccacaatgaaaccgcagtcaagatcttggtatccccatcgggc
gcaggcctctag

DBGET integrated database retrieval system