KEGG   Clostridium drakei: B9W14_08130Help
Entry
B9W14_08130       CDS       T05484                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
cdrk  Clostridium drakei
Pathway
cdrk00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:cdrk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    B9W14_08130
Enzymes [BR:cdrk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     B9W14_08130
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     B9W14_08130
    1.1.1.-  
     B9W14_08130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Gp_dh_N
Motif
Other DBs
NCBI-ProteinID: AWI04463
UniProt: A0A2U8DP47
Position
1798812..1799855
Genome map
AA seq 347 aa AA seqDB search
MKTIACVKVGSLKDPDVNKRGRVQVIDMPEQEMGDEDVKIKVAYCSICGSDPHLVEGIFG
LEPPFGIGHEISGTIVEIGKKAVKKGLKVGDRVAGNFLRFCGTCYYCRNGQEQFCEYPDN
KPGMSEYVVWHESQVFKVPDDVSLEEACLLEPVSIAVRIVDKTNMKIGQRVAISGGGPIG
LLSLQAMKMFGATSLTLIEPIKERQELAKEFGADYIINPLEQDVCVESNKITNGLGFDLV
IEASGSPKAAPAASEIAAKGGTVLYIAMFPKNYDMPLNLYDKLYSKELTISSINVAPYAF
PRATEIMPRMNLKPFIQKIFTIDQAEEAFAAQISGKYPKILIKCNDF
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaagactattgcttgtgttaaggtaggaagtttaaaagatcctgatgttaataaaagg
ggacgtgttcaggttatagatatgcctgagcaggaaatgggagatgaggatgtcaagata
aaggttgcttactgttcaatatgtggttctgatccacatttagtagaaggaatttttggt
cttgaacctccctttggaataggacatgagatttcaggcactattgtggaaattggtaaa
aaggctgttaaaaagggattaaaagtaggggacagggttgcaggaaattttttaagattt
tgtggtacatgttattattgccgaaatggtcaggagcagttctgtgaatatccggataat
aagcctggtatgtccgaatatgtagtatggcatgaatctcaggtatttaaagttccagat
gatgtaagcttagaagaagcgtgcttgttagagcctgtgtcaattgcagttagaattgtg
gacaaaacaaatatgaaaattggccaacgagttgccatttcaggaggaggacctatagga
ttattgtcacttcaagcaatgaagatgtttggagctacgtcacttacacttatagaacct
attaaggaaagacaggaacttgccaaagaatttggtgctgattatattatcaatcctttg
gagcaggatgtatgtgtagaatccaataaaataactaatggattgggttttgacctggta
atagaggcttcgggatcacctaaggctgcaccagcagctagtgaaatagctgcaaaagga
ggaactgttctctatattgcaatgtttccaaaaaactatgacatgccactgaatctatat
gacaaactgtacagtaaggaattgactatttctagcataaatgtagctccatatgcattt
ccacgtgctactgaaattatgcctagaatgaatttaaaaccttttatacagaaaatcttt
actattgatcaggcagaagaagctttcgctgctcaaattagtggaaaatatcccaaaata
cttatcaaatgtaatgatttttaa

DBGET integrated database retrieval system