KEGG   Clostridium drakei: B9W14_09450Help
Entry
B9W14_09450       CDS       T05484                                 

Definition
(GenBank) selenide, water dikinase SelD
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
cdrk  Clostridium drakei
Pathway
cdrk00450  Selenocompound metabolism
cdrk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdrk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    B9W14_09450
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cdrk03016]
    B9W14_09450
Enzymes [BR:cdrk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     B9W14_09450
Transfer RNA biogenesis [BR:cdrk03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    B9W14_09450
 Prokaryotic Type
    B9W14_09450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS A_deaminase
Motif
Other DBs
NCBI-ProteinID: AWI04704
UniProt: A0A2U8DR64
Position
2107779..2108813
Genome map
AA seq 344 aa AA seqDB search
MVQKRLTELSKTSGUAAKIGPETLSKILGKLPKIEDKNLIVGIETSDDDAVYKLNDEMAV
IQTLGFFTSVVDDPYTFGQIAAANSISDVYAMGGIPTVALNIVCFPSCLSIDVLGEILRG
GADKVIEAGAVVIGGHTVEDDEPKYGLSVMGIAHPDKILKNFGSKVEEDVIITKPLGTGI
INTAIKGGMASKKAYDEAVKVMATLNKYAGEIIENYNVSACTDVTGFGLMGHGYEMAEAS
DVTFKLYKDKIPYIKDAKEYAEMGLVPAGAYNNRKYIQDKFEFKNTPEWMKDILFDPQTS
GGLLITCSKTESIKIMEELSELELPSAIIGEVITKQEEGYIIVE
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggttcaaaaaagacttacagagctaagtaaaacttcaggatgagcagcgaaaataggg
ccggagaccctgtcaaaaatattaggaaagttgcctaaaatagaagataaaaatttaata
gtaggaatagaaacctctgatgatgatgctgtctataagttaaatgatgaaatggcggtt
atacaaacactgggtttttttacttcagtagttgatgatccttatacctttgggcaaatt
gctgcggcgaattctataagcgatgtatatgcaatgggtggaataccaacagtagcatta
aatatagtgtgttttccaagttgtttatctatagatgttttaggagaaatattaagagga
ggagcagataaggtaattgaagcaggagcagttgttataggaggtcatactgtagaagat
gatgagccaaagtatggattgtctgtaatgggaatagcccatccagataaaattcttaaa
aattttggttcaaaggttgaagaggatgtcattataacaaagcccttaggaacgggaata
ataaatactgctataaaaggtggaatggcatctaagaaagcttacgatgaagctgtaaag
gttatggctacattaaataaatatgcaggagaaataattgaaaattacaatgtttcagct
tgtacggatgtaactggttttggacttatgggacatgggtatgaaatggctgaagcttca
gacgtcacttttaaattatataaggataaaataccttatataaaagatgcaaaagagtat
gcggaaatgggacttgtaccagcaggagcatataataacagaaaatatatacaagataaa
tttgagtttaaaaatacaccagaatggatgaaggatatattatttgatccacaaacatca
ggaggtcttttaataacctgttcaaaaacagaaagtattaagataatggaggaactttca
gaattggaattaccgtcagcgattattggtgaggtaataactaagcaagaagaaggttat
ataatagtagaataa

DBGET integrated database retrieval system