KEGG   Clostridium drakei: B9W14_17925
Entry
B9W14_17925       CDS       T05484                                 

Definition
(GenBank) ornithine aminomutase
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
cdrk  Clostridium drakei
Pathway
cdrk00472  D-Arginine and D-ornithine metabolism
cdrk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdrk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    B9W14_17925
Enzymes [BR:cdrk01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     B9W14_17925
SSDB
Motif
Pfam: OAM_alpha
Other DBs
NCBI-ProteinID: AWI06302
UniProt: A0A2U8DW74
Position
complement(4047059..4047424)
AA seq 121 aa
MKREDDYAKRREHLKGLTDEQLYDKFWSLTSEIVKPLVDLSYQYTSPAIERSVLLRMGFS
SLEAQPIVEYGTKWNLLGKGIGNVVLTYAKLKNMDYLKAGEELSKGIGWNLVIDKMKGGE
K
NT seq 366 nt   +upstreamnt  +downstreamnt
atgaaaagggaagatgattatgcaaagagaagagagcatttaaaaggtttaacagatgaa
caactttatgataaattttggagccttacttctgaaattgtaaagcctttagttgatcta
tcttatcaatatacatccccagctattgaacgttcagtacttttaagaatggggttttcc
agtctagaagcgcagccaatagttgaatatggaaccaagtggaatttattgggtaaaggt
ataggaaatgtggttttgacctatgcaaaattaaaaaatatggattacttgaaagcagga
gaggaattatccaaaggaataggatggaatttagtaatagacaaaatgaaaggcggtgaa
aaataa

DBGET integrated database retrieval system