KEGG   Corynebacterium diphtheriae C7: CDC7B_0277Help
Entry
CDC7B_0277        CDS       T01699                                 

Definition
(GenBank) ABC-transport system permease protein
  KO
K02033  peptide/nickel transport system permease protein
K02034  peptide/nickel transport system permease protein
Organism
cds  Corynebacterium diphtheriae C7
Pathway
cds02024  Quorum sensing
Module
cds_M00239  Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:cds00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CDC7B_0277
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cds02000]
    CDC7B_0277
Transporters [BR:cds02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    CDC7B_0277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AEX66476
Position
276228..277988
Genome map
AA seq 586 aa AA seqDB search
MTMRSPRTLATVVIAVATYALALVATALLPWFTGREPAFAVLRAREREREATPELLQAIR
EQFDLPHTPWESVSRWFAGVARGDFGTSWVNPAQGAWSQATHGLGITATLTFVSTVLCLI
VALLIVMPRIAAAARGRRGGVAAPQLLAALAALPDFVVAVILLWLCALVLHILPVGGWSS
PAHMVLPSLALGVCAGGVYGRVLLITADSASQKPWVEAWRINGVAHSRITRALLWRSFVP
TIPLLTLFFAGTLASTAAVEVTFNIPGFGRTVVNSALNADLPVLQAAVFVVLVVGALSGI
VANTLRRIILRRLEGDVAGVSLSTGTTATSVVFDRVSLIIAAIPLVAVAAGMIRSAAINT
DDRFASYSAAHPLGADQLGRDIWARLADGFTYSIGVAVLVTALCALIGLIAGHLGSWVLH
IGDALNAFPAVLLGLILAGALGPSTTTAAIAVLMVGWIPLASHCAAVVQEARASGHYRYA
ATMGASRWHLLRHHVLPWTTPAVIRHAVVRIAHNAISLAALGYLGVGASVGSPDWGVILE
ESTHYLERAPWMAIGPMLCLVALGVVAAVATDSVGRRQASSYHQPE
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgactatgagatcgcctcgcaccctcgccacggttgttatcgctgtggcaacctatgcg
ctcgctttggtagccaccgcactattgccttggtttaccggccgcgaacccgctttcgct
gttcttcgagcccgtgagcgcgaacgcgaggcgactcctgaacttcttcaggccatccgt
gagcaatttgatctcccacacaccccgtgggaatcagtatcccgctggtttgcgggagtc
gcccgcggtgactttggcacctcctgggtcaaccccgcacaaggtgcatggtcccaagcc
acacacggcttagggatcaccgccacgctgacctttgtctccactgttttgtgtctgatc
gtggcgttgctcatcgtgatgccccgaatcgcagccgctgcccgcggacgacgtggggga
gtagcagccccccagcttttagcagccctagcagcgcttcctgactttgtggtggccgtg
atcttgttgtggctgtgtgccctagtgctgcacatcctgccagtgggcgggtggtcctcg
cccgcacacatggtgctgccctccctagcattgggagtatgcgccggtggcgtgtacggc
agagtgctgctcatcaccgcagattctgcctcccaaaaaccgtgggtagaggcatggcgt
atcaatggcgttgcgcacagtcggatcacccgcgcactgctgtggcgtagttttgtcccc
acgattccactgctcacactcttttttgctggcacccttgccagcactgcggcagtagaa
gtgacctttaacatcccaggattcgggcgcactgttgtcaattctgccttgaatgcggat
ctgccagtgctgcaggcggcagtatttgtggtgcttgtggtgggcgcgttaagcggaatt
gtggcaaatacgctgcgccgaatcattctgcgtcgcctcgaaggcgatgtggcgggcgtg
tcgctgagcaccggcacgacggccaccagcgtggtgtttgaccgcgtgagcctcattatt
gcggcgatcccactggttgctgttgccgcaggcatgatccgcagcgcagcgatcaacacc
gatgaccgctttgccagctattcggcagcgcaccccttgggtgccgaccagctaggccgt
gacatctgggcacggcttgccgacggcttcacgtactccatcggcgtggctgtcctcgta
accgcgctttgtgccctcatcggcctgatcgcaggacatttaggcagctgggtgctccac
atcggcgacgccctcaatgctttcccagcggtcctcctcggcctcattcttgccggtgcc
ctaggtccttctaccaccacagctgcgatcgccgttttgatggtggggtggatcccgctg
gcctcccactgcgcagcggttgttcaagaagcccgcgctagtggacactaccgctacgca
gcaaccatgggtgcaagccggtggcacctgctgcgccaccatgtgctgccatggaccacc
cccgccgttatccggcacgctgtggtgcgcattgcccacaacgcgatctccctagccgcg
ttgggctacctcggtgtcggagcaagcgttggcagccccgattggggagtgatcttggaa
gaatccactcactaccttgaacgtgccccgtggatggccattggtccgatgttgtgcttg
gtggccctaggggttgtggctgcggtggctacggacagcgtggggcgtcgacaagcgtct
agttatcaccagcctgaataa

DBGET integrated database retrieval system