KEGG   Corynebacterium diphtheriae C7: CDC7B_0278Help
Entry
CDC7B_0278        CDS       T01699                                 

Definition
(GenBank) hypothetical protein
Organism
cds  Corynebacterium diphtheriae C7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2867 NAD_binding_10 NmrA Epimerase 3Beta_HSD Semialdhyde_dh adh_short PAC2 RmlD_sub_bind GDP_Man_Dehyd NAD_binding_7 NAD_binding_4
Motif
Other DBs
NCBI-ProteinID: AEX66477
Position
complement(277966..279459)
Genome map
AA seq 497 aa AA seqDB search
MNSTITPTLNLKAQHAERRVVVTGASGYVGARLVVELLSAGFHVRATSRSLSSLKRFPWY
DQVEAVEADLSISEDVNRLFEDVDTVFYLVHSMSGTQNFEELESKIASKVAQAAHSNGVR
QIIYLSGLHPRTELDKLSPHMRSRENVARILGSTAVPAITFRAATLIGSGSASFEMIRHL
TERLPIMVAPQWINNKIEPISIRDTLYYLVKAADLPKPINEEFDIGGGHTYTFADLLRLY
GKIRGLRRTIVSLPISLPFDTLSGLWIAAITPAPLSLAQPLAQSMQEDAICTNRSIRDYI
PDPPSGLTDYPTSVRRALQQESMGVLSSWDSSWKNLSSTDHLPSDPEWTGRTVYSDVQEQ
SFRSEPAKVWRVIEGIGGHHGWYSTPLLWFVRGVIDKAIGGPGLGGRRDPNRLRVGDRVD
FWRVEEVIPEKQLTLRAEMRASGQAWLQFTINGNKLRQRAVYFPKGLLGRVYWLALIPFH
AVIFPTMLRNIIQAGDN
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgaactccaccatcaccccaacgttgaatctgaaagcccagcatgccgaacgacgcgtc
gtagtcacgggagcatcaggctatgtcggtgctcggttagtagtcgaattactcagtgct
ggctttcatgtgcgtgctacttcacgcagtctctcaagcttgaagcgctttccttggtat
gaccaagtagaagccgttgaagcagacttaagcatatctgaagacgtcaatcggctcttt
gaggacgtagatactgttttctatctcgtccattccatgagcggtactcaaaactttgag
gaattggaatcaaagatcgcatccaaagtagcccaagctgctcacagcaacggggtacgt
caaattatctacctttctggcctacatcctcgaacagagctcgacaaattatccccacac
atgcgttcacgggaaaacgttgctcgcatcttgggctccactgctgtacctgcaatcacg
ttccgtgccgctacattgattggctcaggttctgcttcatttgaaatgatccgccacctc
accgaacgcctccccatcatggtggcaccacaatggatcaacaataaaattgagcctatt
agtatccgcgacaccctctattacctcgtcaaagctgctgatctacctaaaccaatcaat
gaagaattcgatatcggaggcgggcatacttacacgtttgcggaccttctgcgactatat
gggaagatccgcggcttacgccgcaccattgtgtccctaccaatctccctccccttcgac
accctttccggactctggattgcagctataactccagctccgttgagccttgcacaaccg
cttgcacaatccatgcaggaagatgccatatgcaccaaccgttcaatccgcgactatatc
cctgatccaccgagtgggctcaccgactaccccacttcagtgcgccgcgcactccaacaa
gaaagcatgggggtgctgtctagttgggacagcagctggaaaaatctttcttccacagat
catcttccttctgatccggaatggacagggcgtaccgtttatagcgacgttcaggaacag
agttttcgttcagaaccagctaaagtgtggcgagtaattgagggcatcggcggacaccat
ggttggtattccacaccgctgctctggtttgtacgtggtgttattgataaagctatcggc
ggacccggcttaggagggcgccgcgaccccaaccgactacgagttggcgaccgcgtagat
ttttggcgagtcgaggaagtcatccctgaaaaacaactcactctccgtgcagaaatgaga
gcatctgggcaagcttggctacagttcaccataaacggcaataaacttcgacagcgggcg
gtttatttccccaaaggactgcttggcagagtgtactggctagcgcttattcctttccat
gccgtgatatttcccaccatgttgcgcaacattattcaggctggtgataactag

DBGET integrated database retrieval system