KEGG   Corynebacterium diphtheriae C7: CDC7B_0283Help
Entry
CDC7B_0283        CDS       T01699                                 

Definition
(GenBank) hypothetical protein
Organism
cds  Corynebacterium diphtheriae C7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4862 AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AEX66481
Position
287625..288659
Genome map
AA seq 344 aa AA seqDB search
MVSAPVVVVMGLLSRVLVTLWDQTSDVWSTLIIVTMPPHFCKGKTMNTTPLVIGAYAALP
ATRADQETFYDRLHADLEATGLELPFRDSIHDDPAWLASQLAGRFTDSIITAIPGTMMRV
WDGGTFGLASPDDDGRNAAIAFTRSIIDSARALDDAAGHRVIAGIHIHSAPSVTANRDQF
LRSLSELLEGMDNDDPRLIIEHCDRYNEAVTGEKRFLSIEQEIAIAKETGIGITVNWGRS
AMEAYDTQLPARHIQALVAEGVFEGVMFSGAGDKENTFGAAWADLHLPHHVDEPASLMDD
DRIAECLSAAGGAQKYHGAKIQAAAEADVATRVTMLGHITRHLR
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggtgagtgcgccggttgtggtggtcatggggttactttcaagggtgttggtcactctt
tgggatcagacgtctgacgtctggagtacgctcataattgttacgatgccaccgcacttt
tgcaaggggaaaaccatgaacaccacaccactagtcatcggtgcctacgcagcactaccc
gccacgcgcgccgaccaagaaactttctacgatcgcctccacgccgatcttgaagccacc
ggccttgaacttccattccgcgacagcattcacgacgaccccgcgtggctcgccagccaa
ctcgcaggacgattcaccgactccatcatcaccgcgatccccggcaccatgatgcgcgtc
tgggacggcggcaccttcggcctcgcctccccagatgacgacggacgcaacgccgccatc
gccttcacccgcagcatcatcgacagcgcccgcgcgcttgacgacgcagccggccaccgc
gtaatcgcaggaatccacatccattccgcaccaagcgtgaccgccaaccgcgaccagttc
ctccgctcacttagcgaactactcgagggcatggacaacgacgacccccgcctgatcatc
gagcactgcgaccgctacaacgaggccgtgaccggcgaaaagcgcttccttagcatcgag
caagaaatcgccatcgccaaagaaaccggcatcggcatcaccgtgaactgggggcgttcc
gcaatggaagcctacgatacccaactgccagcacggcacatccaagcactcgtcgctgag
ggcgtattcgaaggcgtgatgttctccggtgccggcgacaaagaaaacaccttcggcgct
gcatgggccgacctacatctgccacaccacgtcgacgagccagcatcactcatggacgat
gaccgcatcgcagaatgcctcagcgccgcaggcggggcacagaaataccacggtgccaag
atccaagccgccgcggaagccgacgtggcaacacgagtaaccatgctcggccacatcacg
cgacacctccgctaa

DBGET integrated database retrieval system