KEGG   Corynebacterium diphtheriae C7: CDC7B_0284Help
Entry
CDC7B_0284        CDS       T01699                                 

Gene name
cya
Definition
(GenBank) adenylate cyclase
  KO
K01768  adenylate cyclase [EC:4.6.1.1]
Organism
cds  Corynebacterium diphtheriae C7
Pathway
cds00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:cds00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CDC7B_0284 (cya)
Enzymes [BR:cds01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     CDC7B_0284 (cya)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_cyc HAMP KduI
Motif
Other DBs
NCBI-ProteinID: AEX66484
Position
complement(288664..290190)
Genome map
AA seq 508 aa AA seqDB search
MTKLWRAFKWLFKTSWPLYATTVLGSNVLGAVGVMLFLKYLVPLPEFDQFTDEASYLPDL
GIGYLILAVIFGGAVTFLLFRPVLDWQRHPDTHDPNMVRNLVMRIPIYQAALCSVVWALG
IVVLAIAAGQTSPRLALAIAVASTLSGAVIVVLTYLEAQRLVRPVAATALARRFEDSTLE
PPITSRLRLTWALTSAVPIIGILLMVMGHHLGMFTDNVSDIMPAVIALAMSALITGFLGT
TLSIMSVVDPILELQGAINRVRRGDSGVQVDIYDGSEIGVLQAGFNEMMRGLKERQRVRD
IFGRYVGVEVARRALEERPQLGGEDREVAVVFVDVIGSTTFAVNHDPEEVVEELNRFFEH
VVEVVHRNKGIINKFQGDAALAVFGAPVTLSDATGHALTAARELRQELMGLRLEAGIGVA
SGHVVAGHIGGHDRFEYTVIGDAVNTAARLTEIAKNTPGRVLTNSATLQRANEAEQARWT
MMKSVELRGRSLMTQLARPIRPTLADRS
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaactatggcgcgccttcaagtggctgtttaagacttcgtggccgttatacgca
accacggtattgggctccaatgtgttgggcgcggtgggggtcatgttgttcctgaagtac
ttggtgccgctgccagagtttgaccagttcaccgatgaagccagctacctacctgatctg
ggcattggttatttgatcctggcggttatttttggtggcgcggtcacctttttgttgttt
cgtccggtgttggactggcagcgccatccggatacgcatgatccaaacatggttcgtaat
ttggtgatgcgtatcccgatctaccaggcggcgttgtgcagcgtggtgtgggcgctgggc
attgtggtgttggcgattgccgctgggcagacttcgccacgcttggcattggccattgcg
gtggcttcgacgcttagtggtgctgtgatcgtggtgctcacctacttggaggcgcagcgg
ttggtgcggccggtggcagcaacggcgctggctcgtcgttttgaggattccacgttggag
ccgccgattacttcgcgtctgcggctcacgtgggcgttgactagcgcggtgccgatcatt
ggcattttgttgatggtgatgggccaccacttaggcatgtttacagataatgtcagcgac
attatgcctgcggtcattgcgttggctatgtccgcgctaattaccggatttttgggtact
accctttcgatcatgagtgtggtggatccgattttggagctgcagggggcgatcaatcgg
gtgcgtcgcggggattcgggtgtccaggtggacatttacgacggctccgagatcggtgtg
cttcaggccggcttcaatgagatgatgcgtggtttgaaggagcgccagcgtgtgcgcgat
attttcggccgctatgtgggtgtagaggttgcccggcgcgctttagaggagcgcccgcaa
ctaggcggcgaggatcgtgaggttgccgttgtgttcgttgacgtgattggttcgaccacg
ttcgccgtcaaccatgatccagaagaggttgtggaggagctcaatcgtttctttgagcat
gtggtggaggttgtgcaccgcaacaagggcattattaataagttccaaggcgatgctgcg
ctggctgtttttggtgcgccagtcacgctttccgacgccaccggccacgccctcaccgcc
gcccgcgagctgcgtcaggagctcatgggcttacgccttgaggccggtattggtgttgcc
tctggtcacgtagtggccggtcacatcggtggtcatgatcgctttgagtacacggtgatc
ggtgacgctgtgaatactgcggcgcgtctgacggagatcgccaagaacacccctggtcgc
gtgctcaccaactctgctacgttgcagcgcgccaacgaggcggagcaggcacggtggacg
atgatgaagtccgtggagttgcgtggtcgttctttgatgacacagcttgcacggcctatt
cgcccaacgttggcggatcgttcctaa

DBGET integrated database retrieval system