KEGG   Corynebacterium diphtheriae C7: CDC7B_0290Help
Entry
CDC7B_0290        CDS       T01699                                 

Definition
(GenBank) putative secreted protein
Organism
cds  Corynebacterium diphtheriae C7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4025 DUF3959
Motif
Other DBs
NCBI-ProteinID: AEX66489
Position
295057..295638
Genome map
AA seq 193 aa AA seqDB search
MRKFIAGAASFLVLAGASGMAHAVTSEQVPNEVVTNGTVDQRRVSSLELSREPNERRDQL
LNEGFLKEAEQEFPGYTIETYRNTSNGVTVEYDVVAWNDDLTTVTPYINFEWNWGPRIYI
TGAEFWSLGSSGFAGAVCSRFAGWKAGAACSAVASAAWNKIASRHAILSDQTCYDLSQFI
NIGWKRAPQEKCA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgcggaagtttattgctggcgctgcatcatttttagtcttggcaggggcatctggaatg
gctcatgctgtaacttctgaacaagtgcctaatgaggtggtgacgaatgggactgttgat
caacggcgggtgtcgtcgttggaattgtctcgtgaacctaatgaacggcgtgatcaatta
ctgaatgaaggatttttaaaagaagctgaacaagaatttcctggatatactatagaaaca
tatcgtaacaccagtaatggagttaccgttgagtacgatgtggttgcttggaatgatgat
ttaaccacggtaactccatatatcaattttgaatggaattggggtccacgtatttatatt
accggtgctgagttttggtctctcggttcttcagggtttgctggtgcagtttgttcacgt
tttgcaggatggaaggcgggggcagcgtgttctgctgttgcttcggcggcttggaataaa
atagcctctagacatgcaattctttctgatcaaacctgttacgatttaagccaatttata
aacattggctggaagcgtgctccgcaagaaaagtgtgcataa

DBGET integrated database retrieval system