KEGG   Corynebacterium diphtheriae C7: CDC7B_0291Help
Entry
CDC7B_0291        CDS       T01699                                 

Definition
(GenBank) putative membrane protein
Organism
cds  Corynebacterium diphtheriae C7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NnrS CTP_transf_1 DUF4910
Motif
Other DBs
NCBI-ProteinID: AEX66490
Position
295645..295971
Genome map
AA seq 108 aa AA seqDB search
MKKIDSLSMRNSRLAPVVCVILVFFSSVYTIFCHGFFAFDAVVFIVVAVVLARRLGKTKN
KESESAIGIIAVGSVVHVLNLAHMIDLPAFGLGLIIAGAVVLFVADYL
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagattgattcactctcgatgaggaattccaggctggcgccggtagtctgcgtt
atccttgtgtttttttcttctgtctacactatcttttgccatgggttttttgcatttgat
gcagtggtttttattgttgtagcggtagtgctggcgcgtcgtcttggaaaaacgaaaaat
aaggagagtgaatcagcgattgggatcattgcagttggttctgtagtgcatgttcttaat
ctggcacatatgattgatttaccagcgtttggattaggactcattattgctggggcggtt
gtattatttgttgctgattatctatag

DBGET integrated database retrieval system