KEGG   Corynebacterium diphtheriae C7: CDC7B_0296Help
Entry
CDC7B_0296        CDS       T01699                                 

Definition
(GenBank) hypothetical protein
Organism
cds  Corynebacterium diphtheriae C7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fic_N Fic T6SS_VipA
Motif
Other DBs
NCBI-ProteinID: AEX66495
Position
complement(298732..299889)
Genome map
AA seq 385 aa AA seqDB search
MSIFRPKIDITHQYVYSFDMSSTTFDPNRPFNELPPLPPAQVVETVPVLKAIIAAKEKLA
ELRTACQLIPNPEILTSTIPLREARASTEIENIVTTNDELFRAAWNVDAEPTPATKEALR
YNAALHAGLESIGQRPLSAKTTQIVCGTLQSDEPHIAPFRSYPGTFIGNPHTQQRIYTPP
EGREVIEQHLSRWERYIYSEHDVDSLVKMALLHYQFEAIHPFTDGNGRTGRILNVLYLLQ
EALLPFPVLYLSGYIVENKAQYYRCLNRVTTESAWEDWLLFMIRGVEIAATDAATMIADL
RQVQDEITAVIRDAGIISPAKEMSEITMVRPYLRIQDVEDSGLVKRQTATTWLNHLVDIG
VLSETKRGRQRIFINDAALRVLTRE
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatttttcgcccaaaaatcgacattactcaccaatatgtttattctttcgacatg
agcagcaccacgttcgaccccaaccgtcctttcaacgagcttccacctctgccccctgcc
caagtcgtcgaaaccgttccggtgctcaaagcgattattgctgcaaaagaaaagcttgct
gagctacgcaccgcttgccagcttattcccaatccggagattcttacttccacgattccg
ttgcgcgaagcacgcgcgtctacagaaatcgaaaacatcgtaaccacaaacgatgagctt
ttccgcgctgcctggaacgttgacgcagagccgaccccggcaactaaagaagctctgcgt
tataacgccgccttgcatgcgggcttggaatcgatcggtcaacggccactatctgccaag
accacgcaaatagtctgcggaactttgcaaagcgatgaaccgcacattgcgccgtttcgc
tcttaccctggaacattcatcggtaacccgcatacgcaacagcgcatctacactccacct
gaagggcgagaagtgattgagcagcacttatcgcgttgggagcgctatatctatagcgag
catgacgttgattctttggtaaagatggctctgttgcattatcagttcgaagccatccac
ccgtttaccgacggtaacggacgcacagggcgtatcctcaatgtgctgtatctgctgcaa
gaagccctgcttccgttccctgtgctttatttatccggctatatcgtggagaacaaggcg
caatattatcgttgcttgaaccgagtgacaacggaatctgcttgggaagattggcttttg
tttatgatccgcggcgtggagattgcagccaccgacgccgctactatgatcgcggactta
cgtcaggtacaagatgagatcacggctgttatccgcgatgcgggcattattagtccggct
aaagaaatgtctgaaatcacgatggtgcgcccgtacctacgcattcaggatgtggaagac
agcggactagtgaaaagacaaacggccacaacgtggcttaatcatctggttgatattggg
gtgttgagtgaaactaagcgaggccgtcagcgcattttcattaacgatgccgcattgcgc
gtactcacgcgggagtaa

DBGET integrated database retrieval system