KEGG   Corynebacterium diphtheriae C7: CDC7B_0313Help
Entry
CDC7B_0313        CDS       T01699                                 

Gene name
lpd
Definition
(GenBank) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
cds  Corynebacterium diphtheriae C7
Pathway
cds00010  Glycolysis / Gluconeogenesis
cds00020  Citrate cycle (TCA cycle)
cds00260  Glycine, serine and threonine metabolism
cds00280  Valine, leucine and isoleucine degradation
cds00620  Pyruvate metabolism
cds00630  Glyoxylate and dicarboxylate metabolism
cds00640  Propanoate metabolism
cds01100  Metabolic pathways
cds01110  Biosynthesis of secondary metabolites
cds01120  Microbial metabolism in diverse environments
cds01130  Biosynthesis of antibiotics
cds01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cds00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDC7B_0313 (lpd)
   00020 Citrate cycle (TCA cycle)
    CDC7B_0313 (lpd)
   00620 Pyruvate metabolism
    CDC7B_0313 (lpd)
   00630 Glyoxylate and dicarboxylate metabolism
    CDC7B_0313 (lpd)
   00640 Propanoate metabolism
    CDC7B_0313 (lpd)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CDC7B_0313 (lpd)
   00280 Valine, leucine and isoleucine degradation
    CDC7B_0313 (lpd)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cds04147]
    CDC7B_0313 (lpd)
Enzymes [BR:cds01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     CDC7B_0313 (lpd)
Exosome [BR:cds04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   CDC7B_0313 (lpd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 NAD_binding_8 FAD_oxidored FAD_binding_3 FAD_binding_2 Thi4 HI0933_like GIDA 3HCDH_N DAO AlaDh_PNT_C 2-Hacid_dh_C ThiF NAD_binding_7 UDPG_MGDP_dh_N ApbA TrkA_N Ldh_1_N Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: AEX66512
Position
317231..318640
Genome map
AA seq 469 aa AA seqDB search
MTEHYDVVVLGAGPGGYVAAIRAAQLGKKVAVVEKQYWGGVCLNVGCIPSKALLKNAEVA
HIFNHEAKTFGISGDVSFDFGAAHKRSRQVSSGIVKGVHYLMKKNKITEIDGLGSFKDAK
TIEITEGNDAGKVVTFDDCIIATGSVVRSLPGVTIGGNIVSFEEQILKEEAPKSMVIVGA
GAIGMEFAYVLANYGVDITIVEFMDRVLPNEDADVSKEIAKQYKKLGVKLLTGYKTTAIT
DNGDNVTVEVESKDGSKKDSLTVERCMVSIGFAPRVEGYGLENTGVKLTERGAIEIDDFM
RTNVDHIYAIGDVTAKLQLAHVAEAQGVVAAEVIAGAETQELGDYMMMPRATFCNPQVAS
FGYTEEQAKAKFEGREIKTATFPFSANGKAAGLAETAGFVKIVADAEFGEIVGAHMVGAN
VSELLPELTLAQRFDLTCEEIGRNVHTHPTLSEAMKEAAEGIMGHMINL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
gtgactgaacattatgacgtagtagtactcggtgcaggccctggtggctatgtcgccgcc
atccgcgcagcccagcttggcaagaaggttgcagtcgttgaaaagcagtactggggaggt
gtctgcctcaacgtcggttgtatcccttccaaggcgcttctgaaaaacgctgaggtagca
cacatctttaaccatgaggcaaagaccttcggcattagtggcgacgtgtcctttgacttc
ggtgctgctcataagcgctcccgccaggtatcttccggaatcgtcaagggtgtccactac
ttgatgaagaagaacaagatcaccgaaatcgacggcctcggctcctttaaagacgccaag
accatcgagatcaccgagggtaacgacgccggcaaggtagttactttcgatgactgcatt
atcgccaccggttccgtcgtgcgttccctgcctggtgtgaccatcggcggtaacatcgtt
tccttcgaagagcagatcctcaaggaagaagcaccaaagtccatggtgatcgtgggcgcc
ggcgctatcggtatggagtttgcttacgttctcgctaactacggcgtagacatcaccatc
gtggaattcatggaccgcgtactgcctaacgaggatgcagacgtatccaaggagatcgca
aagcagtacaagaagctcggcgtgaaactgctgaccggttacaagaccaccgccatcacc
gataacggcgacaacgtcaccgtcgaggtggagtccaaggacggctccaagaaagacagc
ctcaccgttgagcgctgcatggtgtccatcggattcgcaccacgtgttgaaggctacggc
ctcgaaaacaccggtgtgaagctcaccgagcgcggcgctatcgaaatcgatgacttcatg
cgcaccaacgtcgaccacatttacgcaattggcgacgtcaccgcgaaattgcagctggca
cacgttgcagaagcacagggcgttgttgccgccgaggttatcgccggtgctgaaacccaa
gagctgggcgactacatgatgatgccacgcgctaccttctgtaacccacaggttgcctcc
ttcggctacaccgaagagcaggcgaaggcaaaattcgaaggccgcgagatcaagaccgcc
accttcccattctctgccaacggcaaggcagccggcctcgctgaaactgcaggctttgtc
aagattgttgcagacgcagaatttggcgagatcgtcggtgcgcacatggttggcgcaaac
gtttccgaactgctgccagaactcaccttggcacagcgtttcgacctcacctgtgaagaa
atcggacgcaacgttcatacgcacccaaccctgtctgaggcaatgaaggaagccgcagaa
ggaatcatgggtcacatgatcaacctctaa

DBGET integrated database retrieval system