KEGG   Corynebacterium diphtheriae C7: CDC7B_0318Help
Entry
CDC7B_0318        CDS       T01699                                 

Definition
(GenBank) hypothetical protein
Organism
cds  Corynebacterium diphtheriae C7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1282 Phage_holin_3_6 TLC YtpI
Motif
Other DBs
NCBI-ProteinID: AEX66517
Position
324341..324691
Genome map
AA seq 116 aa AA seqDB search
MSHSLDATQESGNYPVFEGRMHYIDGYDPSSLWAPHSSLQRTSTWVGMGAILAALAGLGT
LIFGLASSTVGSQEAWSTYALIGGVIAAVLLIGGFGLIHMGRAAYRQYRAETGRVN
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgtcccattccctagatgcgacgcaagagtcgggtaactacccggtcttcgagggtcgt
atgcactacatcgacggttatgatccatcgagcctgtgggcaccgcactcctccctccag
cgtacgagcacgtgggtaggtatgggcgcaattcttgccgcattggcaggcttgggtacc
ttgatcttcggtttggcatccagcactgtgggaagccaggaagcttggtctacctacgct
ctgatcggcggagtcatcgcagcagtattactgatcggtgggtttggcttgatccacatg
gggcgcgctgcttaccgtcagtaccgtgcagaaactggtcgcgtgaactaa

DBGET integrated database retrieval system