KEGG   Corynebacterium diphtheriae C7: CDC7B_0324Help
Entry
CDC7B_0324        CDS       T01699                                 

Definition
(GenBank) putative oxidoreductase
  KO
K04069  pyruvate formate lyase activating enzyme [EC:1.97.1.4]
Organism
cds  Corynebacterium diphtheriae C7
Brite
KEGG Orthology (KO) [BR:cds00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CDC7B_0324
Enzymes [BR:cds01000]
 1. Oxidoreductases
  1.97  Other oxidoreductases
   1.97.1  Sole sub-subclass for oxidoreductases that do not belong in the other subclasses
    1.97.1.4  [formate-C-acetyltransferase]-activating enzyme
     CDC7B_0324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM Fer4_12 Fer4_14
Motif
Other DBs
NCBI-ProteinID: AEX66523
Position
complement(327687..328562)
Genome map
AA seq 291 aa AA seqDB search
MADGINSTVTVERSDGPRHRGTAAGIGGLDLDLEDVTHKELIEARRTGDVGLVHSWELVT
AVDGPGTRMTMFMSGCPLRCLYCHNPDTMGMKEGTVERVESIVKKIKRYRNVFKASGGGL
TISGGEPLFQIAFTRRVLKEVHDAGIHTTIDTSGYLGARLTDEDLENIDLVLLDVKSGDE
ETYHRVSGGRELQPTIDFGNRLNAIGKPVWIRFVLVPGVSDAPENINNVADIVAQWKDNV
ERVEVLPFHNMGADKWHELGLNYELEDTKPPTPESVEFAKETFRSRGLTVY
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggctgatggtattaactccacagtgacggttgaacgctctgacgggccgcgccaccgc
ggaaccgcagccggcatcggaggcctcgacctcgatctggaagacgtcacccacaaagag
ctcatcgaggcccgccgcactggcgacgtcggccttgtgcactcctgggagcttgtcacc
gctgttgatggtcctggtacccgcatgaccatgttcatgtccggatgcccactacgatgc
ctttactgccacaaccccgacaccatggggatgaaagaaggcacagtagagcgcgtcgaa
tcgatcgtgaaaaagatcaaacgctatcgcaacgtgtttaaggcctccggcggcggattg
accatctccggcggtgagccactgttccaaatcgcctttacgcgccgcgtactcaaagag
gtacatgatgccggtatccacaccaccatcgacacctcagggtatctcggggcacggctc
acggacgaggacctagaaaacatcgacctcgtgcttctcgacgtcaaatccggcgatgag
gaaacctaccatcgtgtttccggcggccgcgagctacaacccaccattgactttggcaat
cgcctcaatgcgattggcaaacctgtgtggatccgcttcgtgctggtacctggtgtgtct
gatgcaccagaaaacatcaacaacgtggcagacatcgtcgcccagtggaaagacaacgtc
gaacgcgttgaggtgctgcctttccacaacatgggtgccgataagtggcacgaactcggc
ttgaattacgagctcgaggacacaaaaccaccaacaccggaatccgtggagtttgctaag
gagactttccgctcccgcggtttgaccgtctactag

DBGET integrated database retrieval system