KEGG   Corynebacterium diphtheriae C7: CDC7B_0325Help
Entry
CDC7B_0325        CDS       T01699                                 

Gene name
pfl
Definition
(GenBank) formate C-acetyltransferase
Organism
cds  Corynebacterium diphtheriae C7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gly_radical
Motif
Other DBs
NCBI-ProteinID: AEX66524
Position
complement(328641..328892)
Genome map
AA seq 83 aa AA seqDB search
MSSKTFEERMTEMKAKRDENNANAGLYHANINVLDQKTLEDAMENPDKYPNLTVRVSGYA
VNFVKLTREQQLDVLSRTFHHSA
NT seq 252 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctaagacctttgaagagcgcatgaccgagatgaaggcaaagcgcgacgagaac
aacgccaacgctggcctttaccacgcaaacatcaacgtcctcgaccagaagaccctcgag
gatgccatggagaaccctgacaagtacccgaacctcaccgttcgtgtttccggctacgcc
gtcaactttgtcaagctcacccgtgagcagcagctggacgttctttcccgtacgttccac
cactctgcgtaa

DBGET integrated database retrieval system