KEGG   Corynebacterium diphtheriae C7: CDC7B_0330Help
Entry
CDC7B_0330        CDS       T01699                                 

Gene name
fadD6
Definition
(GenBank) acyl-CoA synthetase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
cds  Corynebacterium diphtheriae C7
Pathway
cds00061  Fatty acid biosynthesis
cds00071  Fatty acid degradation
cds01100  Metabolic pathways
cds01212  Fatty acid metabolism
cds02024  Quorum sensing
Module
cds_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:cds00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CDC7B_0330 (fadD6)
   00071 Fatty acid degradation
    CDC7B_0330 (fadD6)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CDC7B_0330 (fadD6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cds01004]
    CDC7B_0330 (fadD6)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cds04147]
    CDC7B_0330 (fadD6)
Enzymes [BR:cds01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     CDC7B_0330 (fadD6)
Lipid biosynthesis proteins [BR:cds01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   CDC7B_0330 (fadD6)
Exosome [BR:cds04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   CDC7B_0330 (fadD6)
  Exosomal proteins of breast cancer cells
   CDC7B_0330 (fadD6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AEX66529
Position
complement(333915..335621)
Genome map
AA seq 568 aa AA seqDB search
MGAFDDKAWLQHYGDWTPASLDYGDTTLVDIYDNNLAVNADKPATYFFGRTQTYAELDAQ
VRAAAAGLKAFGIRPGDRVAIVLPNCPQHIAAFYAIQLLGATVVEHNPLYTAHELEGLFQ
DHGARVAIAWDKAASTLEKLRDTTSLETIISVNMTEAMPRIQQLALRIPIPPIAAKREQL
TAFADNTVPWSTLIGNAIGGNGKRTEFPKVTRDDIALILYTSGTTGTPKGALLSHGNLVS
NCFMGKAWVPGLGDQPERFLAALPMFHAYGMTMVGTLGVFVGAEMVLLPAPQIPLIMKIM
KNHTPTWLPGVPTLYEKIVAEATAKGVEIKGIRNSFSGASTLPVRTVEDWENLTGGLLVE
GYGLTETSPVLCGNPMNGNRRPGYIGVPFPDTEIRIANPDNLDETMPDGEAGEVLARGPQ
IFQGYLNKPEATAATFHGDWFRTGDMGVMEEDGFIRLVSRIKEIIITGGFNVYPAEVEEA
LIAHPDVDDAAVVGRPRKDGSEDVVACIVLKDGAALDPEGLKTHCRKLLTRYKVPRTFYH
FEALNKDQLGKVRRREVQQTLLERLGEK
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcattcgacgacaaagcatggttgcaacactatggcgactggacaccagcatcc
ctcgactacggcgacaccacgctggtagacatctacgacaacaaccttgccgttaacgcc
gacaagcccgcgacctacttcttcggacgcacccaaacctatgcagagctcgatgcccaa
gtacgcgcagccgcagcaggccttaaagcctttggtatccgcccaggcgaccgcgtcgcc
atcgtattgcccaactgcccgcagcacatcgccgcgttctacgccatccagctgctcggc
gccaccgtcgtagagcacaacccgctctacaccgcacacgagctcgaaggcctcttccaa
gatcacggcgcacgcgtcgccatcgcatgggacaaagcagcctccaccctagagaaactg
cgcgacaccacctcgcttgagacgatcatctccgtcaacatgacagaggccatgccacgc
atccaacaactagcgctgcgcataccgatcccacccatcgccgcaaagcgcgaacaactc
accgcgtttgccgacaacaccgtcccatggtccaccctgatcggcaatgctatcggcggc
aacggtaaacgcaccgaattccccaaggtcaccagagacgacatcgccctaatcctgtac
acctccggcaccaccggaacgccgaagggcgcgctgctctcccacggcaacttggtgtcc
aactgcttcatgggcaaggcgtgggtaccaggactgggcgaccaacccgagcgtttcctc
gcagcccttcccatgttccacgcctacggcatgaccatggtcggtaccctcggtgtcttc
gttggcgcagaaatggtcctgctaccagcaccgcagatcccactgatcatgaagatcatg
aaaaaccacacccccacgtggctgccaggtgtgcccaccctctacgaaaagatcgtggca
gaagccaccgccaagggcgtggaaatcaaaggcatccgcaactccttctccggtgcctcc
accctgccagtacgcaccgtcgaagactgggaaaacctcaccggcggcctgctggtggaa
ggctacggcctgaccgaaacctccccagttctgtgcggtaaccccatgaatggcaaccgc
cgccccggctacatcggcgtaccgttccccgacaccgaaatccgcattgccaacccagac
aacctcgacgagacaatgcccgacggcgaagccggcgaagttctcgcccgcggaccacag
attttccaaggctacctcaacaaaccagaagcaaccgcagccaccttccacggtgattgg
ttccgcaccggcgacatgggtgttatggaagaagacggttttatccgcctagtaagccgc
atcaaggaaatcatcatcaccggcggatttaacgtctaccccgccgaggtcgaagaagcc
ctgatcgcccacccagacgttgacgacgcagccgtagtcggccgcccacgcaaagacggc
tccgaggacgtggtagcctgcatcgtgctcaaagacggtgcagccttggacccagaaggc
ctcaaaactcactgccgcaagctgctcacccgatacaaagtgccacgcaccttctaccac
tttgaagcactcaacaaagaccaactcggtaaggtccgccgccgcgaagtgcagcagacc
ctcctcgaacgcctcggagaaaagtaa

DBGET integrated database retrieval system