KEGG   Corynebacterium diphtheriae C7: CDC7B_0334Help
Entry
CDC7B_0334        CDS       T01699                                 

Definition
(GenBank) two-component system sensor histidine kinase
  KO
K07768  two-component system, OmpR family, sensor histidine kinase SenX3 [EC:2.7.13.3]
Organism
cds  Corynebacterium diphtheriae C7
Pathway
cds02020  Two-component system
Module
cds_M00443  SenX3-RegX3 (phosphate starvation response) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:cds00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CDC7B_0334
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cds01001]
    CDC7B_0334
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:cds02022]
    CDC7B_0334
Enzymes [BR:cds01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     CDC7B_0334
Protein kinases [BR:cds01001]
 Histidine kinases
  OmpR family
   CDC7B_0334
Two-component system [BR:cds02022]
 OmpR family
  SenX3-RegX3 (phosphate) [MD:M00443]
   CDC7B_0334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA HATPase_c_5 HATPase_c_3
Motif
Other DBs
NCBI-ProteinID: AEX66533
Position
339567..340715
Genome map
AA seq 382 aa AA seqDB search
MYVVIAFVLGVVLSGLALPALKWVRGRSYRTAKKGDNKVTTVSQMLHLTVQGSPTGMAVI
DATGAVLLSNVRSHEMGIVHERTLNPDIWELAQEAYKDQETHAIELVIDERRNRITSVRA
VVKPLTLVDDRYVVIYSTDESENQRMEAARRDFVANVSHELKTPVGGMALLAEAITEASD
DQEQVKYFGNRLYKEAHRLADMINELISLSKLQGAEALPDLEPVSVDRVIDEALARNVLA
ADNAGIELNRGKPCNAMVMGDMTLLVTAVSNLISNAINYSPQGMPISVATKISRDGRVLI
RVIDNGIGISMENQKRVFERFFRVDKARSRSTGGTGLGLAIVKHVAANHGGDVTLWSRPG
TGSTFTIELPIYHETDTGRRKD
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
gtgtacgtcgttatcgcatttgtgttgggcgtggtcctttcgggcctcgccctacctgcg
ttgaaatgggtgcgcggccgtagttatcgaacggcgaaaaagggggataataaggtcacc
actgtgagccagatgctgcatttgacggtgcagggctcgcccacgggtatggcggtgatc
gacgctacgggggccgttttattgtctaatgtacgttcccacgagatggggattgtgcat
gagcgcacgcttaatccggatatttgggagcttgcgcaagaagcttataaagaccaagag
actcatgcgattgagctggtgatcgacgagcggcgtaatcgcattacgtcggtgcgtgcg
gtggttaagccactgacgcttgtcgacgaccgctacgtggtcatttacagcacggatgag
tcggaaaaccagcgtatggaagcggcacgtcgtgactttgtggctaacgtgtcccatgag
ctgaaaactcctgtgggtggcatggcgttgctggcggaggccatcacggaggcctctgat
gatcaagagcaggtgaaatattttggtaatcgcctgtacaaagaggcccaccgtcttgcc
gacatgattaatgagctcatctcgttatccaagctgcaaggtgctgaggcgttgccggat
ctagagccggtgagtgtggatcgtgtgatcgacgaggcactggcacgcaatgtgttggcc
gccgataatgcgggcattgaactcaaccgtggcaaaccatgcaatgcgatggtgatgggg
gatatgacgctgctggtcacggcggtgtccaacctgattagcaacgctattaattattcg
ccacagggaatgcccatttcggtggcaaccaagatttcgcgggatggccgtgttcttatc
cgagtgatcgataatggcattggcatttcaatggagaatcaaaaacgagtgtttgagcgc
ttcttccgtgtagataaagcgcggtcgcgttctacaggtggtacgggattagggcttgcg
attgtcaagcatgtggcagctaatcacggtggcgatgtcacgctgtggtcgcgtcctgga
accggttccacgtttacgatcgagcttccgatctatcatgaaactgacacgggtcgccga
aaggattag

DBGET integrated database retrieval system