KEGG   Corynebacterium diphtheriae C7: CDC7B_0337Help
Entry
CDC7B_0337        CDS       T01699                                 

Definition
(GenBank) hypothetical protein
  KO
K01524  exopolyphosphatase / guanosine-5'-triphosphate,3'-diphosphate pyrophosphatase [EC:3.6.1.11 3.6.1.40]
Organism
cds  Corynebacterium diphtheriae C7
Pathway
cds00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:cds00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CDC7B_0337
Enzymes [BR:cds01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.11  exopolyphosphatase
     CDC7B_0337
    3.6.1.40  guanosine-5'-triphosphate,3'-diphosphate phosphatase
     CDC7B_0337
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ppx-GppA
Motif
Other DBs
NCBI-ProteinID: AEX66536
Position
342266..342493
Genome map
AA seq 75 aa AA seqDB search
MRLGVLDVGSNTVHLVAVNASQGGRPRSGALVAEAAMRALNIEQLEICPWALREGVILRR
TEQGIVPEETSKGDE
NT seq 228 nt NT seq  +upstreamnt  +downstreamnt
gtgagattaggtgtattggacgttggcagtaacacggttcatcttgtggcggtgaatgcg
tcacaaggtgggcgcccccgctccggcgcgttggtcgctgaggcggcgatgcgtgcgctt
aacattgagcagttagagatttgcccgtgggctttgcgcgagggagtcatacttcgacgc
acggaacagggtattgtgccagaagaaacctcaaaaggagatgagtag

DBGET integrated database retrieval system