KEGG   Corynebacterium diphtheriae C7: CDC7B_0339Help
Entry
CDC7B_0339        CDS       T01699                                 

Gene name
proC
Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
cds  Corynebacterium diphtheriae C7
Pathway
cds00330  Arginine and proline metabolism
cds01100  Metabolic pathways
cds01110  Biosynthesis of secondary metabolites
cds01130  Biosynthesis of antibiotics
cds01230  Biosynthesis of amino acids
Module
cds_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:cds00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    CDC7B_0339 (proC)
Enzymes [BR:cds01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     CDC7B_0339 (proC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored Shikimate_DH ApbA NAD_binding_2 PDH GFO_IDH_MocA CoA_binding_2 Sacchrp_dh_NADP TrkA_N Semialdhyde_dh Peptidase_M41 NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: AEX66538
Position
343156..343968
Genome map
AA seq 270 aa AA seqDB search
MFAMTSIAVIGGGKIGEALISGLVASGMSPKDIHVTNRNAERARDLKERYGVLTFLENVA
AVDDVDMVFLCVKPQQVIPVVEEIADVVDNNTSTTIVSMAAGVTNAMIEESLAAGSPVIR
VMPNTPMLVGKGMSVVAPGRYADEDTVASLTQLLEAVGSVEVIEESSMDAVVALSGSSPA
YLFLMVEALIDAGVFLGLPRDKAKNLAVSSFAGAATMLEQTGEEPAVLRANVSSPGGTTI
AAIREFEESGLRAAVYRAATAAATRNSSLG
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
gtgttcgccatgacttcaatcgcagtaattggtggcggcaagattggcgaggcattgatt
tcgggcctcgtggcaagtggcatgagtccaaaagatattcatgtgactaatcgcaacgct
gagcgtgctcgggacctcaaggaacgctatggcgtattgaccttcctagaaaatgttgcc
gctgttgacgacgtagacatggtgtttttgtgtgtgaagccgcagcaggtcattcccgtt
gtggaagaaatcgcagacgttgtagataacaacaccagcaccactatcgtgtcgatggcc
gctggcgtgaccaacgccatgatcgaggagagccttgctgcaggttcccctgttatccgt
gtgatgcctaatactcctatgttggtgggtaagggcatgtccgtggtggctcctgggcgt
tatgccgatgaggacacggtggcgtcgttaacgcagctgttggaggctgtgggcagcgtg
gaggtcatcgaggaatcgagcatggacgcggtggtggcgttgtcgggttcttctcctgcg
tatctctttttgatggttgaggcgcttatcgacgccggcgtgttccttggcctaccacgt
gataaggcgaaaaacttggctgtttcttcctttgctggcgctgccacgatgttggagcaa
acgggtgaggagccagcagtattgcgtgcaaatgtgagctcgcctggcggtactacgatt
gctgctattcgggagtttgaggaaagcggtttgcgtgctgcggtctatcgtgcggcgact
gctgcggcgacacgcaacagttctttgggctag

DBGET integrated database retrieval system