KEGG   Corynebacterium diphtheriae C7: CDC7B_0343Help
Entry
CDC7B_0343        CDS       T01699                                 

Definition
(GenBank) hypothetical protein
Organism
cds  Corynebacterium diphtheriae C7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD Hydrolase Hydrolase_3
Motif
Other DBs
NCBI-ProteinID: AEX66542
Position
complement(345619..346662)
Genome map
AA seq 347 aa AA seqDB search
MSQSIPEPHWHQTPQEFLASWSTSRGNLRRFFEEHALPPIDARTQREAGEAAAELAASEL
FGIKLDEYTSGLDSVSGSFEAAGAQHVTTANPEIPQDIGAAAFFDIDNTLIQGSSLVVFA
MGLAKKKYFKLNEILPVAWKQIKFRVTGNENAHDVAEGRQQALEFIKGRRVDELVALCEE
IVDNNMSEKLWPGTKQLADQHIADGQQVWLVSATPVQLAQALAKRLGFTGALGTVAEVKD
GVFTGRLVGDILHGPGKLHAVAALATIERLDLSRCTAYSDSINDVPMLSMVGTAVAINPD
RPLAKVAKQHGWAVRDYRSLRKAIRTFGIPALVTAAFSFGGWKAWRR
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
gtgagtcagtccatcccagaaccccactggcatcagaccccccaagaattcttggccagc
tggtccacttcccgtggcaacctacgccggttcttcgaggaacacgccctcccgcctatc
gacgcccgcacgcagcgcgaagccggcgaagccgccgcagaactcgccgccagcgaactc
tttggcatcaaactcgacgaatacacctcagggctcgactctgtgtccggctccttcgaa
gccgccggcgcccagcatgtcacaacagccaaccccgaaatcccccaagacattggggca
gccgcgttctttgacatcgacaacacgttgattcaggggtcgtcgctcgttgtttttgcc
atgggattggccaagaaaaagtactttaagctcaacgaaatactgcccgttgcatggaag
cagattaaatttcgggtcaccggcaacgaaaatgctcacgacgtcgccgaaggccgccag
caagccctcgagttcattaaaggccggcgtgtcgacgagctcgtagccctgtgcgaggag
atcgtcgataacaatatgagcgaaaagctctggcctggcaccaaacaactggctgaccag
cacattgccgacggccaacaagtatggcttgtcagtgccacccccgtgcaacttgcccaa
gcccttgccaaacggcttggttttaccggcgcgctcggcaccgtcgccgaggtcaaagac
ggcgtgtttaccggccgcctcgtcggcgacatcctgcacgggcccggcaaactccacgcc
gtggccgcgctcgcaaccatcgaacgccttgatttaagccgctgcaccgcctactcagac
tccatcaacgacgtccccatgttgtcgatggtaggaacagctgtggctattaaccccgat
cgcccgctagcaaaagtggccaagcaacacggctgggcagttcgcgactaccgcagcctg
cgcaaggccattcgtacgtttggtatccccgccctcgttactgccgcctttagttttggt
ggctggaaggcgtggagaaggtag

DBGET integrated database retrieval system