KEGG   Corynebacterium diphtheriae C7: CDC7B_0353Help
Entry
CDC7B_0353        CDS       T01699                                 

Gene name
hemG
Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
cds  Corynebacterium diphtheriae C7
Pathway
cds00860  Porphyrin and chlorophyll metabolism
cds01100  Metabolic pathways
cds01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cds00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CDC7B_0353 (hemG)
Enzymes [BR:cds01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     CDC7B_0353 (hemG)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     CDC7B_0353 (hemG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO FAD_binding_2 Pyr_redox_2 HI0933_like Thi4 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AEX66552
Position
357221..358573
Genome map
AA seq 450 aa AA seqDB search
MRIAIIGAGLAGLTAAYGLRDHDVSVFEATDRIGGKLHTVAFQSGPTDMGAEAYLAFRED
TTAFFKELGLEVVSPSGLPSLLYVNGELHPMPMNTVMGIPGSSKGLEKLVSAETAARIDA
ESDSMDWPQEVTLGEVLRERFGDDLVDHVVSALQGGVYSSTSDDLSLRDTVPQLARALDR
LKEEGKPVTITAAVQSIMADREKRNKARGYKPSVFAAFPGGYAELYEALAEKSGAKIHID
AFITGIQWKDGFTLTGAEGTFDKVIVAVPAPTAAMLLKSVAPEASALLKNIKLASSAVVG
MKFDSAEGLPDNSGILVATDAEVTAKAFTFSSKKWPHLGQRGGALVRASFGRFGDDAIAR
ADEDLLVDTALDDLQTVTGFDGRAAGLSEIYVQRWFGGLPVYGPGHSDLVAAIKDALPEG
IYATGAWADGVGVPAVIDSATKVAKLLEDH
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtattgcaatcattggtgcggggcttgcgggtttgactgcggcgtatggtcttcgt
gaccatgatgtttcggttttcgaggcgactgaccgtattggtggcaagctgcatacggtt
gcgtttcagtctggccctacggatatgggtgcggaggcgtatttggcgtttcgtgaggat
acgacggccttttttaaggagttaggtcttgaggttgtgtcgccttcggggttgccgtcg
ttgttgtatgtcaatggtgagttgcatccgatgccgatgaatacggtgatggggattcca
ggctcgtcgaagggtttggaaaagttggtgagcgcggagactgccgcgcgtatcgacgcc
gaatctgattccatggactggccccaggaggtgactctgggggaggttttgcgtgagcgc
tttggcgacgacctcgtggatcacgtggtgtcggcgttgcagggtggcgtgtattcctct
acttctgatgatctttcgttgcgggacacggttccgcagttggcgcgtgcgttggatcgt
ctgaaagaagaaggcaagccagtcacaattaccgctgcggtgcagtcgattatggctgat
cgtgagaagcgtaataaggcccgtggttataagccgagtgtgtttgcggctttccctggt
ggttatgcggagctgtatgaggcgctggcggagaagtcgggtgcgaagatccacattgat
gcctttattactggcattcagtggaaggatgggttcacgctgacgggtgctgagggaacc
tttgacaaggtgattgtggcggttccagctccgacggcggcgatgttgttgaagtctgtg
gcaccggaggcgtcggcgttgctgaaaaacatcaagttggcgagctctgcggtggtgggt
atgaagttcgattccgcggaggggctgccggataattcgggcattttggttgcgacggat
gcagaggttactgcgaaggcgtttacattttcttcgaagaagtggccgcatttggggcag
cgtggtggcgcgttggtgcgtgcgtcgtttggccgttttggtgatgatgccattgcgcgt
gccgacgaagacctgctggtggataccgcacttgatgatcttcagactgttacgggtttt
gatggccgtgcggctgggctgtcggagatatatgtgcagcgctggttcggtggcttgccg
gtgtacgggccagggcatagcgatcttgtggctgcgattaaggacgcactgccagagggt
atttatgccactggcgcttgggccgatggcgtgggtgttcctgcggtgattgattctgca
actaaggtggcaaagctactggaagatcactga

DBGET integrated database retrieval system