KEGG   Corynebacterium diphtheriae C7: CDC7B_0357Help
Entry
CDC7B_0357        CDS       T01699                                 

Gene name
ccdA1
Definition
(GenBank) cytochrome c-type biogenesis protein
  KO
K06196  cytochrome c-type biogenesis protein
Organism
cds  Corynebacterium diphtheriae C7
Brite
KEGG Orthology (KO) [BR:cds00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cds02000]
    CDC7B_0357 (ccdA1)
Transporters [BR:cds02000]
 Other Transporters
  Transmembrane electron carriers [TC:5]
   CDC7B_0357 (ccdA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DsbD
Motif
Other DBs
NCBI-ProteinID: AEX66556
Position
361084..361875
Genome map
AA seq 263 aa AA seqDB search
MNILASGLGESVADVASSGPLLLGILAAALAGFVSFASPCVIPLVPGYMSYLAGVVGAEV
ELSETGPRVRTRRWRVVGAALLFVLGFTVVFTLATATVFGAISALTLNAGTLMRIGGVVT
IVMGLVFMGAVPMLQEEHRFSPRRWSTILGAPLLGGVFALGWTPCLGPTLAAIISVSAGT
EGMTALRGVLLIIGYCVGLGIPFLIVALGSARVMMGLRKYSRIIQIIGGCALVLVGLALV
SGQWAHFVNWVRQWTVEYGATLI
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaatattctcgctagtggactaggggaaagcgtcgcagatgtcgcttcctctggtcct
ctccttttaggtattttggccgctgcattggcaggttttgtttccttcgcgagtccttgc
gtcatcccgcttgttcctggttacatgtcctatcttgcaggcgttgtgggcgcagaagtc
gagctcagtgagactggccctcgggtgcgcactcgtcgatggcgagttgttggtgcggct
ttattgttcgtccttgggttcacggtggtatttactttggccacggccactgtttttggt
gcgattagtgctctgacattaaatgctggcactttgatgcgtatcggcggtgtggtcact
atcgtcatgggacttgtgttcatgggtgcggttccgatgttgcaggaagagcaccgtttt
tctcctcgtcggtggtcgacaattctgggtgccccgcttctggggggagttttcgctttg
ggctggactccatgtttggggcctacgctcgccgcaattatttctgtttccgcaggtact
gagggtatgaccgcgttgcgaggtgtgctgctcattattggttattgcgtgggtttgggc
attcctttccttattgttgcgttgggttctgctcgcgtgatgatgggtctgcgtaagtat
tcccgcattattcaaatcatcggtggttgtgcgttggttttggtggggctggcgttggtg
tctgggcagtgggctcattttgttaactgggtacgtcaatggaccgtcgagtacggtgcc
acgttgatttaa

DBGET integrated database retrieval system