KEGG   Corynebacterium diphtheriae C7: CDC7B_0363Help
Entry
CDC7B_0363        CDS       T01699                                 

Gene name
menA
Definition
(GenBank) 1,4-dihydroxy-2-naphthoateoctaprenyltransferase
  KO
K02548  1,4-dihydroxy-2-naphthoate octaprenyltransferase [EC:2.5.1.74 2.5.1.-]
Organism
cds  Corynebacterium diphtheriae C7
Pathway
cds00130  Ubiquinone and other terpenoid-quinone biosynthesis
cds01100  Metabolic pathways
cds01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cds00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    CDC7B_0363 (menA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:cds01006]
    CDC7B_0363 (menA)
Enzymes [BR:cds01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.74  1,4-dihydroxy-2-naphthoate polyprenyltransferase
     CDC7B_0363 (menA)
    2.5.1.-  
     CDC7B_0363 (menA)
Prenyltransferases [BR:cds01006]
 Compound prenylation
  DHNA octaprenyltransferase
   CDC7B_0363 (menA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UbiA
Motif
Other DBs
NCBI-ProteinID: AEX66562
Position
complement(365193..366056)
Genome map
AA seq 287 aa AA seqDB search
MSQATFADWKEGARPHTWANAFAPVIVGTGAAGAGIVWWKALLALIVAWALIIGVNYAND
YSDGIRGTDDDRTGPLRLTGSGLAEPAAVKRAAFIAFGFAGIAGIALSLTSAWWLIAIGL
LCVAGAWFYTGGKNPYGYRGLGEVAVFIFFGLVAIMGTQFTQLGHVTYTGFACSVAIGAM
SAGVNLVNNLRDIPTDKESGKITLAVRLGDPTTRILYYVLITLPFLASISFFSWGSLGLL
ALPLAVKAAQPVKNGATGKDLIPVLGTTGKAMLAWSLLTTIGLIILA
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaagcaacctttgccgattggaaagaaggcgctcgcccacacacttgggcaaac
gccttcgcgcccgtcatcgtgggaaccggtgcagccggggccggaatcgtatggtggaaa
gccttactcgcactcatcgtggcctgggccctcatcatcggggtcaactacgccaacgat
tactccgacggcatccgcggcacggatgacgaccgcaccggtcccctccgcctcaccgga
tccggacttgccgagccggcagcagtaaaacgcgcagcatttatcgccttcggattcgcc
ggcatcgcaggaattgccctatccctcaccagcgcatggtggctcatagcaatcggcctc
ctatgcgtcgcgggagcatggttctacaccggcggaaaaaatccatacggataccgcgga
cttggcgaggttgccgtcttcattttcttcggcctagtcgcaatcatgggcacacaattc
acccagcttgggcacgtcacatacacaggattcgcctgctcggttgcgatcggcgcaatg
tccgcaggagtaaacctagtaaacaacctgcgcgatatccccacagacaaagaatccggc
aagatcacccttgccgtccgactcggcgatcccacaacccgcattctgtattacgtgctc
atcaccttgccgtttctcgcttccatatcgtttttctcttggggatcgctaggtttactc
gcactccccctagcggtcaaagctgcacagcccgtaaaaaatggtgccacaggaaaggat
ctcatccccgtccttggcaccaccggaaaagccatgctggcatggtcactactgaccact
atcggtttgataattctcgcttaa

DBGET integrated database retrieval system