KEGG   Corynebacterium diphtheriae C7: CDC7B_0369Help
Entry
CDC7B_0369        CDS       T01699                                 

Gene name
pimB
Definition
(GenBank) putative glycosyl transferase
  KO
K12583  phosphatidylinositol alpha 1,6-mannosyltransferase [EC:2.4.1.-]
Organism
cds  Corynebacterium diphtheriae C7
Brite
KEGG Orthology (KO) [BR:cds00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cds01003]
    CDC7B_0369 (pimB)
Enzymes [BR:cds01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     CDC7B_0369 (pimB)
Glycosyltransferases [BR:cds01003]
 Glycan extension
  Glycolipid
   CDC7B_0369 (pimB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_transf_4 Glycos_transf_1 Glyco_trans_1_4 Glyco_trans_4_4 Glyco_trans_1_2
Motif
Other DBs
NCBI-ProteinID: AEX66568
Position
372032..373123
Genome map
AA seq 363 aa AA seqDB search
MDAGDHPSIEYLGCCKPHLCWFVVDRGPAVKVAIVTESYLPNINGVTNSVLRIEEYAKAH
GHEVLVIAPRICVNVIRTLPIGLPVGVEKRLRAFDPDMIHLASPYAFAARAAFIAQKMAV
PCVAVYQTDVAAYQQHYHLTWLKNAHWSWMRAFHNRAALTLAPSTPAKEQLENHGIKNVQ
LWGRGVDTELFHPRPKNNPKKVVGYVGRLAPEKSVHRLAALNHRDDLEVVIVGDGILREQ
LERAMPNARFLGQLRGEALACEYARFDVFVHTGDHETFGQTIQEAHASGVPVVAPRSGGP
IDLITPANGIFITEGIEQAVDYVLAHDFDPRSTVVTWETVCNQLFAHYRDVVTLDNRGKG
IIG
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
ttggacgctggcgatcatcccagcattgagtatttgggttgttgcaagcctcatctttgc
tggtttgtggtggatcgtgggccggctgtgaaagtcgctattgtcacggagtcctatctt
cccaatatcaatggggtgactaactccgtgctgcggatcgaggaatacgccaaagcacat
gggcatgaggtattggtcattgcgccgcgcatatgcgtcaatgtgattcgtaccttgcct
atcggcctgccggtgggcgtcgaaaagcgacttcgggcgtttgatcctgacatgattcac
ttagcgtcgccctatgcttttgccgcgcgggcggcgtttattgctcagaaaatggcggtg
ccttgtgtggccgtctatcaaaccgatgtggctgcctaccagcagcattatcaccttacg
tggttaaaaaacgcgcattggtcgtggatgagggcgttccataaccgcgcggccttgaca
ttggcgccgtcaacaccggcgaaagagcaactggaaaaccacggaatcaaaaacgtacag
ctctggggtagaggcgttgacactgagctttttcatccgcgtccaaaaaataaccccaaa
aaagtggtgggctacgtgggccggctcgcacctgaaaagtcggtgcaccgcctagcagcg
cttaaccaccgcgacgaccttgaggtggtcattgtgggcgatggcatcctgcgagagcaa
ttagagcgcgcgatgccgaatgctcgatttttaggtcagttgcggggagaggcactggcc
tgcgaatacgcgcgtttcgacgtcttcgtccacactggggatcacgagactttcggtcaa
accatccaagaagcccatgccagcggtgtgccggttgtggcaccgcgctctggtgggccg
attgatttgataacacctgccaacgggatatttattaccgaaggcatagaacaggccgtt
gattatgtgcttgcgcatgactttgatccgcggtcgacagtggtgacgtgggagactgtc
tgcaaccagctcttcgcccattatcgtgatgttgttacactggacaaccgtggcaaaggc
atcattggataa

DBGET integrated database retrieval system