KEGG   Corynebacterium diphtheriae C7: CDC7B_0375Help
Entry
CDC7B_0375        CDS       T01699                                 

Gene name
nusG
Definition
(GenBank) transcription antitermination protein NusG
  KO
K02601  transcriptional antiterminator NusG
Organism
cds  Corynebacterium diphtheriae C7
Brite
KEGG Orthology (KO) [BR:cds00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cds03021]
    CDC7B_0375 (nusG)
   03009 Ribosome biogenesis [BR:cds03009]
    CDC7B_0375 (nusG)
Transcription machinery [BR:cds03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     CDC7B_0375 (nusG)
Ribosome biogenesis [BR:cds03009]
 Prokaryotic Type
  rRNA transcription factors
   CDC7B_0375 (nusG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NusG KOW
Motif
Other DBs
NCBI-ProteinID: AEX66574
Position
378125..378916
Genome map
AA seq 263 aa AA seqDB search
MSEENSFAEAFDEAVQNTISAEAEEFTADGELEVVEETAQEADLTGGEKNEDAEYKARLR
KYTRELKKLPGAWYIIQCYSGYENKVKTNLDMRAQTLEVEDSIFDVVVPIEQAIELRDGK
RKLVKRKLLPGYVLVRMDINDRSWSVVRDTPGVTSFVGNEGNATPVKHRDVAKFLMPQEA
TESEAVNAEGEKVVAMPTDSTKPKTAVDFEVGEAVTILSGAFASVSATISGIDHENAKIQ
ALVSIFGRETPVELAFDQVEKIS
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagaaaacagctttgcagaagcctttgatgaggccgtacagaacacgatttcc
gctgaggctgaagagttcaccgctgacggtgaactcgaagttgtggaggaaactgcccaa
gaggcagatctcaccggcggcgagaagaatgaagacgctgagtacaaggcgcgtctgcgc
aagtacacccgtgagctcaagaagctcccaggtgcttggtacatcattcagtgctattcg
ggatacgagaacaaggtaaagaccaaccttgatatgcgcgcccagaccctcgaggttgaa
gattccatcttcgatgtcgttgttcctatcgagcaggcaatcgagcttcgcgacggaaag
cgcaagctggttaagcgcaagctgctgccgggctacgttttggttcgtatggacatcaac
gatcgctcatggtccgttgttcgcgacaccccaggtgtgaccagcttcgttggcaacgag
ggcaacgccaccccagtgaagcaccgtgacgtcgctaagttcctcatgcctcaggaggct
accgagtctgaggctgttaacgctgagggtgagaaggtcgtcgctatgccaaccgattcc
accaagccaaagaccgctgtggacttcgaggttggcgaggctgtcaccattttgtccggt
gcttttgcctctgtttccgcaaccatttcgggcattgaccacgagaacgcaaagattcag
gcactggtatcgatctttggccgcgaaaccccagttgaattggccttcgatcaggttgag
aagatcagctaa

DBGET integrated database retrieval system