KEGG   Corynebacterium diphtheriae C7: CDC7B_0376Help
Entry
CDC7B_0376        CDS       T01699                                 

Gene name
rplK
Definition
(GenBank) 50S ribosomal protein L11
  KO
K02867  large subunit ribosomal protein L11
Organism
cds  Corynebacterium diphtheriae C7
Pathway
cds03010  Ribosome
Module
cds_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:cds00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CDC7B_0376 (rplK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cds03011]
    CDC7B_0376 (rplK)
Ribosome [BR:cds03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    CDC7B_0376 (rplK)
  Bacteria
    CDC7B_0376 (rplK)
  Archaea
    CDC7B_0376 (rplK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L11_N Ribosomal_L11 SBP_bac_5
Motif
Other DBs
NCBI-ProteinID: AEX66575
Position
379061..379489
Genome map
AA seq 142 aa AA seqDB search
MAPKKKVTGLIKLQIQAGQANPAPPVGPALGAHGVNIMEFCKAYNAATENQRGNVVPVEI
TVYEDRSFDFKLKTPPAAKLLLKAAGLQKGSGVPHTQKVGSVTMDQVKEIAQTKMEDLNA
NDIENAARIIAGTARSMGIEVK
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atggctccgaagaagaaggtcaccggccttatcaagctgcagattcaggctggacaggca
aaccctgctcctccagtcggcccagctcttggtgctcacggcgtgaacatcatggagttc
tgcaaggcttacaacgctgcgactgagaaccagcgcggcaacgtggtcccagttgagatc
actgtgtacgaagaccgctccttcgacttcaagttgaagaccccacctgctgctaagctg
ctgctgaaggctgctggcctgcagaagggttccggtgttcctcacacccaaaaggtcggc
tccgtgaccatggatcaggtcaaggaaatcgcacagaccaagatggaagacctcaacgct
aacgacattgagaacgctgcacgcatcatcgctggtaccgcacgttccatgggtatcgag
gttaagtaa

DBGET integrated database retrieval system