KEGG   Corynebacterium diphtheriae C7: CDC7B_0379Help
Entry
CDC7B_0379        CDS       T01699                                 

Gene name
rplL
Definition
(GenBank) 50S ribosomal protein L7/L12
  KO
K02935  large subunit ribosomal protein L7/L12
Organism
cds  Corynebacterium diphtheriae C7
Pathway
cds03010  Ribosome
Module
cds_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:cds00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CDC7B_0379 (rplL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cds03011]
    CDC7B_0379 (rplL)
Ribosome [BR:cds03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    CDC7B_0379 (rplL)
  Bacteria
    CDC7B_0379 (rplL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L12 Ribosomal_L12_N
Motif
Other DBs
NCBI-ProteinID: AEX66578
Position
381134..381514
Genome map
AA seq 126 aa AA seqDB search
MAKLTKDELIEAFKEMTLIELSEFVKEFEEVFEVTAAAPVAVAAAGAAPAAAEEEKTEFD
VVLEDAGAKKIGVIKAVRELVSGLGLKEAKELVEGAPKAILEGANKDDAEAAKAKLEEAG
AKVTLK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggctaagctcaccaaggacgagctcattgaggctttcaaggaaatgaccctgatcgaa
ctctccgagttcgttaaggaattcgaagaggtcttcgaggttaccgctgctgctccagtt
gctgttgctgctgcaggtgctgctccagctgctgctgaagaagagaagaccgagttcgat
gttgttctcgaggacgcaggcgctaagaagatcggcgttattaaggctgttcgcgagctc
gtctccggcctgggcctgaaggaagctaaggagctcgttgagggtgctcctaaggctatc
ctcgagggtgctaacaaggacgacgctgaggctgcaaaggctaagctcgaagaggctggt
gcaaaggttacccttaagtaa

DBGET integrated database retrieval system