KEGG   Corynebacterium diphtheriae C7: CDC7B_0401Help
Entry
CDC7B_0401        CDS       T01699                                 

Gene name
cstA
Definition
(GenBank) two-component system response regulator
Organism
cds  Corynebacterium diphtheriae C7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg GerE Sigma70_r4_2 Sigma70_r4 HTH_24 HTH_23
Motif
Other DBs
NCBI-ProteinID: AEX66600
Position
406743..407444
Genome map
AA seq 233 aa AA seqDB search
MITVGLVDDQQLVRAGFRMVLDSQSDITVAWEANDGKEALENAANTPVDVILMDVQMPVM
DGLEATKRIVATNTDTRIIVLTTFDSENYVVGAVEHGASGFLLKDTAPEDLIAAVRTVGE
QSAVISPAATAVLFKSMRGHAPQTDLVATPGGDINAGLIDPLTPREQEILLLIALGKSNT
EIAEELFISLPTVKTHVSKVLSKTGSRDRVHAVLFAFSRGLVAPNQLLTHTQG
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
gtgatcactgtagggttagtggatgaccagcagctagtgcgggctgggtttcgtatggtg
ttggattcgcaaagcgatatcaccgtggcgtgggaagccaacgacggcaaagaagcacta
gaaaacgccgcaaatacgccggtagacgtgattttgatggatgtgcaaatgccggtgatg
gatggcctcgaagccaccaaacggatcgtggcaaccaacaccgatacccgcattattgtg
ttgaccacctttgacagcgaaaactatgtggtcggggccgtagaacacggtgcctcagga
ttcctcctaaaagacaccgcccccgaagacctcatagcagcggtgcgtactgtgggagag
caaagcgctgtgattagcccagccgctaccgccgtactgtttaagagcatgcgcggccac
gcaccgcaaaccgacctggtggcaaccccaggcggcgatatcaacgcagggctgattgac
ccacttaccccgcgtgaacaggaaattctgctgcttattgcattgggcaagtccaatacc
gagatcgccgaagaactgttcatctcgttgcccacggtaaaaacccacgtgagcaaggtg
ctatccaaaactggttcccgagaccgagtccatgcggtgctgtttgcttttagcagggga
ttggtagcgcccaaccaactgctgactcatacccagggctga

DBGET integrated database retrieval system