KEGG   Corynebacterium diphtheriae C7: CDC7B_0409Help
Entry
CDC7B_0409        CDS       T01699                                 

Gene name
rpsL
Definition
(GenBank) 30S ribosomal protein S12
  KO
K02950  small subunit ribosomal protein S12
Organism
cds  Corynebacterium diphtheriae C7
Pathway
cds03010  Ribosome
Module
cds_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:cds00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CDC7B_0409 (rpsL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cds03011]
    CDC7B_0409 (rpsL)
Ribosome [BR:cds03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    CDC7B_0409 (rpsL)
  Bacteria
    CDC7B_0409 (rpsL)
  Archaea
    CDC7B_0409 (rpsL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosom_S12_S23
Motif
Other DBs
NCBI-ProteinID: AEX66608
Position
414012..414383
Genome map
AA seq 123 aa AA seqDB search
MPTIQQLVRKGRHDKTAKVATAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLTSG
IEVSAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGALDTQGVKDRKQARSRYGAK
KEK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgcccactattcagcagctggtccgcaagggccgccacgataagactgccaaggttgca
accgcagccctgaagggttccccgcagcgtcgtggcgtgtgcacccgtgtgtacaccact
acccctaagaagcctaactctgcactgcgtaaggtcgcccgtgtgcgccttacctccggc
atcgaggtttccgcttacatcccaggtgagggccacaacctccaggagcactccatggtg
ctcgttcgcggtggtcgtgttaaggacctcccaggtgttcgttacaagatcatccgtggc
gcactggatacccagggcgttaaggatcgtaagcaggcacgttcccgctacggcgcaaag
aaggagaagtaa

DBGET integrated database retrieval system