KEGG   Corynebacterium diphtheriae C7: CDC7B_0414Help
Entry
CDC7B_0414        CDS       T01699                                 

Gene name
rpsJ
Definition
(GenBank) 30S ribosomal protein S10
  KO
K02946  small subunit ribosomal protein S10
Organism
cds  Corynebacterium diphtheriae C7
Pathway
cds03010  Ribosome
Module
cds_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:cds00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CDC7B_0414 (rpsJ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cds03011]
    CDC7B_0414 (rpsJ)
Ribosome [BR:cds03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    CDC7B_0414 (rpsJ)
  Bacteria
    CDC7B_0414 (rpsJ)
  Archaea
    CDC7B_0414 (rpsJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S10 DUF384
Motif
Other DBs
NCBI-ProteinID: AEX66613
Position
419888..420193
Genome map
AA seq 101 aa AA seqDB search
MAGQKIRIRLKAYDHEAIDASAKKIVETVTRTGARVVGPVPLPTEKNVYAVIRSPHKYKD
SREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNIQ
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
gtggcgggacaaaagatccgcattcggctgaaggcctacgatcacgaggcgatcgacgct
tctgcaaagaagattgtcgagacggtcacccgtaccggcgctcgtgttgttggtccagtg
ccgttgcccaccgaaaagaacgtatacgccgttattcgttctccccataagtacaaggat
tctcgcgagcacttcgagatgcgcacgcacaagcgcctgatcgacatcctcgacccgacg
ccgaagacggttgacgcacttatgcgcatcgaccttccggccagcgtcgacgtgaatatt
cagtga

DBGET integrated database retrieval system