KEGG   Corynebacterium diphtheriae C7: CDC7B_0782Help
Entry
CDC7B_0782        CDS       T01699                                 

Gene name
galU
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cds  Corynebacterium diphtheriae C7
Pathway
cds00040  Pentose and glucuronate interconversions
cds00052  Galactose metabolism
cds00500  Starch and sucrose metabolism
cds00520  Amino sugar and nucleotide sugar metabolism
cds01100  Metabolic pathways
cds01130  Biosynthesis of antibiotics
Module
cds_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cds00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CDC7B_0782 (galU)
   00052 Galactose metabolism
    CDC7B_0782 (galU)
   00500 Starch and sucrose metabolism
    CDC7B_0782 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    CDC7B_0782 (galU)
Enzymes [BR:cds01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CDC7B_0782 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AEX66979
Position
789143..790063
Genome map
AA seq 306 aa AA seqDB search
MTSPKSGNSCAVRTVIVPAAGLGTRFLPATKTVPKELLPVVDTPGIELIAEEAAQLGATR
LAVITAPKKQEVLDHFNRFPELEATLESRGKKDQLAKVVRAAELIQPVSVVQETPLGLGH
AVGLAESVLDDDEDVVAVMLPDDLVLPMGVVEKMVEVRRQLGGSVLCAFDVPREDVYNYG
VFDIEECDYDGPYQVKSVKGMVEKPAVEDAPSTFVATGRYLLDRAIFDALRRITPGAGGE
LQLTDAIALLINEGHPVHILVHDGKRHDLGNPGGYIPAVVDFGLSDPTYGPHLKKVLRTI
LEEHGA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgacttcacccaagagtggtaattcgtgtgccgtcagaaccgtgatcgtcccagctgct
ggtttgggtacacggtttctccctgccacaaagaccgtccctaaggagctccttcctgtc
gtcgatacgccaggtatcgagctgattgctgaggaggccgcgcagttgggggcaacgcgt
ttggctgtgattacggcgccgaaaaagcaggaagtgttggatcacttcaacaggttccca
gagctggaagcaacgttggaaagtcgtggcaagaaggatcagctggcaaaggttgtgcgt
gctgctgaactgattcagccggtttctgtggttcaagagactccgcttggtctggggcat
gcagtggggttggcggaaagcgtgttggatgacgatgaagacgtcgtagctgtcatgctt
ccggatgacttggtgctgcccatgggcgttgtggaaaagatggtggaggtgcgtcgccag
ctgggaggctctgtgctgtgcgctttcgatgttcctcgtgaagatgtgtataactacggc
gtctttgatattgaggagtgcgattacgacggcccttaccaagtcaagagtgtgaaaggc
atggtggaaaagccagccgtagaagacgcaccttcgacgtttgttgcaacaggtcgttat
cttttggatcgtgcgatttttgatgcgcttcgccgtatcacccctggtgcgggcggtgag
ctgcagcttactgatgctattgcgttgcttattaatgaggggcatccagtccacatcttg
gttcacgatggaaagcgccatgatttgggaaatcctggtggttatatcccagcggtggtg
gattttggtttgtcggatccgacgtatggcccacatttgaagaaggtcctgcgtaccatt
ttggaagagcacggcgcttaa

DBGET integrated database retrieval system