KEGG   Corynebacterium diphtheriae C7: CDC7B_1473Help
Entry
CDC7B_1473        CDS       T01699                                 

Gene name
ripF
Definition
(GenBank) bifunctional riboflavin kinase/FMN adenylyltransferase
  KO
K11753  riboflavin kinase / FMN adenylyltransferase [EC:2.7.1.26 2.7.7.2]
Organism
cds  Corynebacterium diphtheriae C7
Pathway
cds00740  Riboflavin metabolism
cds01100  Metabolic pathways
cds01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cds00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    CDC7B_1473 (ripF)
Enzymes [BR:cds01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.26  riboflavin kinase
     CDC7B_1473 (ripF)
   2.7.7  Nucleotidyltransferases
    2.7.7.2  FAD synthetase
     CDC7B_1473 (ripF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_syn Flavokinase CTP_transf_like
Motif
Other DBs
NCBI-ProteinID: AEX67666
Position
complement(1520312..1521283)
Genome map
AA seq 323 aa AA seqDB search
MDQVDIWHRLEDIPADLKASVITIGVFDGVHRGHRTLVAAATDRAQALGVPSVLVTFNPH
PLSVLRPDKMPPLLGTVNQRADLAESLGVDHMFAMNFTAELSHLSPEEFFCSVIKDKLNA
QAVVVGKNFTFGYKAAGTTDTLKALGEKYGVEIYVLDLLTENGDVVSSTAIRSDLLEGNI
RRANWGLGREFSVHGDVVRGAGRGGKELGFPTANLYFPDSIALPEDGVYAGWLTVTSSAP
IDGDMVRGVRYPAAISVGHNPTFGDKRRSVESFVLDRHADLYGHSIVVEFVDRIRPMVKF
DGIDELLVAIENDVTQTRAILHI
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
gtggatcaggtggacatttggcacagattagaagatattccagcagacttgaaagcctca
gttatcaccattggcgtattcgatggtgttcaccgtggtcaccgaacccttgtagcagca
gcgactgatcgagcacaagcattgggagttcctagtgtgctcgtgacgtttaacccgcat
ccgttgtcggtcctgcgacctgacaagatgcctccattgctgggaacggtaaatcagcga
gcagatttagcagaatctttaggcgttgatcacatgttcgctatgaatttcactgcggaa
ctctcgcacttgtcgcctgaagaatttttctgttctgtgatcaaagacaaactcaatgct
caagcagtagtagtaggaaagaattttactttcgggtacaaagctgcaggtacgacagac
actctgaaagcattaggggagaagtacggagtcgagatctacgtactggatctactgacg
gaaaatggtgatgtagtgtcctccaccgctattcgatcggatttgctggaggggaatatt
cgccgtgcgaactggggccttggccgtgaattctctgtccacggcgatgtggtgcgtgga
gccggtcgtggcggcaaagaactcggttttccaactgccaacctttattttcctgatagt
atcgcgttgccagaagacggtgtctatgcaggttggctcactgtcacgtcttcggcgccc
attgatggcgacatggtgcgtggagtgcggtatccggctgcaatttcagtcggacacaat
cctacgttcggcgataagcgtcgcagcgtagagtcatttgtactcgaccgccatgccgat
ctttatgggcattccatagtcgtagagttcgttgatcggattcgtccgatggtcaaattt
gatggcattgatgagttgcttgttgccattgaaaatgatgtaactcaaacgcgtgccata
ttgcatatctaa

DBGET integrated database retrieval system