KEGG   Corynebacterium diphtheriae C7: CDC7B_1636Help
Entry
CDC7B_1636        CDS       T01699                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cds  Corynebacterium diphtheriae C7
Pathway
cds00020  Citrate cycle (TCA cycle)
cds00310  Lysine degradation
cds00380  Tryptophan metabolism
cds01100  Metabolic pathways
cds01110  Biosynthesis of secondary metabolites
cds01120  Microbial metabolism in diverse environments
cds01130  Biosynthesis of antibiotics
cds01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cds00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CDC7B_1636 (sucB)
  09105 Amino acid metabolism
   00310 Lysine degradation
    CDC7B_1636 (sucB)
   00380 Tryptophan metabolism
    CDC7B_1636 (sucB)
Enzymes [BR:cds01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CDC7B_1636 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: AEX67829
Position
1703404..1705020
Genome map
AA seq 538 aa AA seqDB search
MAHSVVMPELGESVTEGTITQWLKSVGDTVTADEPLLEVSTDKVDTEVPSPVSGVLLEIK
FEEDDTVDVGDVIAIIGEEGDAPAAKEEQKVEEPQAEAPKAEAADSTDVVMPELGESVTE
GTITQWLKSVGDTVDVDEPLLEVSTDKVDTEVPSPVAGTILEILFNEDDTVDVGDVIVRV
GTPGSAPAAKEEPAKEPKAETPKEEPKAEAPKAEPKKEAPAKTINNENVPYVTPLVRKLA
DKHGVDLTTVEGTGIGGRIRKQDVLAAAGVGAAPAAQVAPAQPVSAASTKSVDPEKQKLI
GTTQKVNRIREITARKTVEALQISAQLTQLHEVDMTKVAELRKANKPAFQEKHGVNLTYL
PFFAKAIVEALVAHPNVNASYNAETKEMTYHADVNLSIAVDTPAGLLTPVIHKAQELSLP
ELAKAIVDLADRARNNKLKPNDLSGGTFTITNIGSEGALSDTPILVPPQAGILGTGAIVK
RPVVITEDGIDSIAIRQMVYLPLSYDHQIVDGADAGRFLTTIKDRLETANFEGDLELS
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggcgcactccgttgtaatgcctgaactgggcgaatccgtcaccgaaggtaccatcacc
cagtggctgaagtccgttggtgacacggtcactgccgacgagccgttgctcgaggtatct
actgacaaggtcgacactgaagttccttcgcctgtctccggtgtcttgcttgagatcaag
tttgaggaagatgacaccgtagacgtcggagacgttattgcgattattggcgaagaaggc
gacgctccagctgccaaggaagagcaaaaagtcgaggagccacaagctgaggcaccaaag
gctgaagcagctgactccaccgacgtagtcatgcctgaactcggcgagtccgtcaccgaa
ggcaccatcacccagtggctgaagtccgttggcgacaccgtcgacgttgacgaaccactc
ctcgaagtctccaccgacaaggtcgacaccgaagtcccatccccagtcgctggcaccatc
ctcgaaatcctcttcaacgaagacgacaccgtcgacgtcggagacgtaatcgttcgcgtt
ggcaccccaggatctgctccagcagccaaggaagagccagccaaggagccaaaagccgag
acaccaaaggaagagccaaaagctgaggcaccaaaggctgagccaaagaaggaagctcct
gccaagaccatcaacaacgagaacgtcccttacgtcactccgctggtccgcaagctggct
gacaagcacggcgttgatctgaccactgttgaaggcactggtattggtggacgcatccgc
aaacaggatgttttggctgctgctggcgttggcgcagcccctgcagcacaggttgctcct
gcccagccagtttctgcagcatccaccaagtccgtggatccagagaagcagaagctgatc
ggtacaactcagaaggtcaaccgtatccgagagatcaccgcgcgcaagactgtggaggct
ttgcagatttctgctcagctcacccagctgcatgaggtcgatatgactaaggttgcggaa
ctgcgtaaggccaacaagccagccttccaagaaaagcacggtgtgaacctcacctacttg
ccattctttgcaaaggcaattgttgaggctttggttgctcacccgaacgtcaatgcgtcc
tacaacgctgagacaaaggagatgacctaccacgctgatgtcaacctctccatcgccgtt
gataccccagctggtctgcttacccctgttatccacaaggctcaggagttgtccttgcct
gagctcgctaaggcaattgtcgatttggctgaccgtgctcgtaacaacaagctcaagccg
aatgatctttccggtggcaccttcaccattaccaacattggttctgagggcgctctcagc
gataccccaatcttggttccaccacaggcaggtatcttgggtaccggcgctattgttaag
cgtccagtagtcatcacggaagatggcatcgattcgattgctattcgccagatggtctac
ttgccacttagctacgatcaccagatcgtcgatggtgccgatgcaggtcgtttcttgacc
accatcaaggatcgccttgagactgcaaacttcgaaggcgacctcgaactctcctag

DBGET integrated database retrieval system