KEGG   Corynebacterium diphtheriae C7: CDC7B_2109Help
Entry
CDC7B_2109        CDS       T01699                                 

Gene name
fadA
Definition
(GenBank) acetyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cds  Corynebacterium diphtheriae C7
Pathway
cds00071  Fatty acid degradation
cds00280  Valine, leucine and isoleucine degradation
cds00310  Lysine degradation
cds00362  Benzoate degradation
cds00380  Tryptophan metabolism
cds00620  Pyruvate metabolism
cds00630  Glyoxylate and dicarboxylate metabolism
cds00640  Propanoate metabolism
cds00650  Butanoate metabolism
cds00900  Terpenoid backbone biosynthesis
cds01100  Metabolic pathways
cds01110  Biosynthesis of secondary metabolites
cds01120  Microbial metabolism in diverse environments
cds01130  Biosynthesis of antibiotics
cds01200  Carbon metabolism
cds01212  Fatty acid metabolism
cds02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cds00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CDC7B_2109 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    CDC7B_2109 (fadA)
   00640 Propanoate metabolism
    CDC7B_2109 (fadA)
   00650 Butanoate metabolism
    CDC7B_2109 (fadA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CDC7B_2109 (fadA)
   00072 Synthesis and degradation of ketone bodies
    CDC7B_2109 (fadA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CDC7B_2109 (fadA)
   00310 Lysine degradation
    CDC7B_2109 (fadA)
   00380 Tryptophan metabolism
    CDC7B_2109 (fadA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CDC7B_2109 (fadA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CDC7B_2109 (fadA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CDC7B_2109 (fadA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cds04147]
    CDC7B_2109 (fadA)
Enzymes [BR:cds01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CDC7B_2109 (fadA)
Exosome [BR:cds04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CDC7B_2109 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_C ECH_1 ECH_2 Dodecin ACP_syn_III_C DUF5423
Motif
Other DBs
NCBI-ProteinID: AEX68295
Position
complement(2218623..2219531)
Genome map
AA seq 302 aa AA seqDB search
MMGEQGSFDAVALKKYPQLETINHVHHAGNSSGIVDGAALTLIGSEKAGADMGLIPRARI
VVTAVNGVEPAVREALAKANLTVDDIDVWEINEAFAAVVKHAQQNLGIDYEKLNIKGGAM
AMGHPLGATGAMITGAAIDELHRISGRYGLISLCVAGGESGITGIIITPAKKTFFAGGDI
KQMSKATEADAEAMFTMVEHMKESLRLEKLPVPIVAVINGAALGGGLEVALAANHRIAAD
ARGSKIGLPEVTLALLPGGGGVSRVVRMIGIQNALMQVILTGAQMNPQPPSGTTPHVAGP
PH
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgatgggtgagcagggcagcttcgacgctgttgcactgaagaaatacccacagcttgag
accatcaaccacgtccaccacgccggtaattcttccggcattgtcgacggcgctgccctg
actctcatcggttccgagaaggcaggcgcggatatgggactgatcccacgcgcacgcatc
gtcgtcaccgccgtcaacggtgtcgagccagctgttcgcgaagcactcgcgaaagcaaac
ctgactgtcgatgacattgatgtctgggagattaacgaggctttcgcagccgtcgtgaag
catgcacagcagaacctgggcattgactacgaaaagctcaacatcaaaggtggcgctatg
gcaatgggccacccactgggtgcgaccggcgcgatgatcaccggcgctgctatcgacgaa
ctgcaccgcatcagcggacgctacggccttatctcgctgtgcgtcgctggcggggaatcc
ggtatcacgggcattatcatcacccccgcgaaaaagaccttcttcgcaggtggcgacatc
aagcagatgtccaaggccaccgaggccgacgcggaagccatgttcaccatggttgagcac
atgaaggagtccctccgcttggagaaactaccggttccaatcgtggcagtcatcaacggt
gcagctctcggcggcggtctcgaggtcgctctcgcagctaaccaccgcattgccgccgat
gcccgcggctccaagatcggcctgccagaggtcaccctcgcccttttgccaggcggcggc
ggtgtctcccgcgtcgttcgcatgattggtattcagaatgcactgatgcaggtcatcctc
accggcgcacagatgaatccgcagccgccaagtggcacgacgccgcacgtggccgggccg
ccgcactag

DBGET integrated database retrieval system