KEGG   Corynebacterium diphtheriae HC01: CDHC01_0328Help
Entry
CDHC01_0328       CDS       T01693                                 

Gene name
gpmA
Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cdt  Corynebacterium diphtheriae HC01
Pathway
cdt00010  Glycolysis / Gluconeogenesis
cdt00260  Glycine, serine and threonine metabolism
cdt00680  Methane metabolism
cdt01100  Metabolic pathways
cdt01110  Biosynthesis of secondary metabolites
cdt01120  Microbial metabolism in diverse environments
cdt01130  Biosynthesis of antibiotics
cdt01200  Carbon metabolism
cdt01230  Biosynthesis of amino acids
Module
cdt_M00002  Glycolysis, core module involving three-carbon compounds
cdt_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cdt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDHC01_0328 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    CDHC01_0328 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CDHC01_0328 (gpmA)
Enzymes [BR:cdt01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CDHC01_0328 (gpmA)
Membrane trafficking [BR:cdt04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    CDHC01_0328 (gpmA)
Exosome [BR:cdt04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CDHC01_0328 (gpmA)
  Exosomal proteins of melanoma cells
   CDHC01_0328 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEX73581
Position
314127..314873
Genome map
AA seq 248 aa AA seqDB search
MTTGKLILLRHGQSEWNASNQFTGWVDVNLTEKGEAEAKRGGELLKAQGVLPSVVYTSLL
RRAIRTANIALNAADRHWIPVVRDWRLNERHYGALQGLNKAETKEKYGDEQFMAWRRSYG
TPPPELEDSSEFSQANDPRYANLDVVPRTECLKDVVERFVPYFKEEILPRVQNGETVLIA
AHGNSLRALVKHLDNISDADIAELNIPTGIPLVYELDEAGTVLNPGGTYLDPEAAAAGAA
AVAAQGAK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgactactggaaaactgattcttcttcgtcacggacaaagcgaatggaacgcttccaac
cagttcaccggctgggtggacgtcaacctcaccgaaaagggcgaggcagaggctaagcgc
ggcggcgaactgctcaaggctcagggggtcctgccaagcgtggtgtacacctctttgctg
cgccgtgctatccgcaccgccaacattgctctgaacgctgctgatcgccactggatccca
gttgttcgcgattggcgcctcaacgagcgccactacggtgcgctgcagggcctgaataag
gctgagactaaggaaaagtacggcgacgagcagttcatggcatggcgtcgttcttatggc
accccaccaccagagcttgaggattccagcgagttctcccaggcaaacgatcctcgttac
gccaaccttgacgtggttcctcgcaccgagtgcttgaaggacgttgttgagcgtttcgtt
ccttacttcaaggaagagatcctgccacgtgtacagaacggtgagactgttttgatcgct
gcacacggtaactccctgcgtgcattggtcaagcacctagacaacatctctgatgcagac
atcgctgagctcaacatccctaccggtattccactggtttatgagctcgacgaggctggc
acggtgctcaacccaggtggcacctaccttgacccagaagctgctgctgctggtgctgcc
gcagttgctgctcagggcgctaagtag

DBGET integrated database retrieval system