KEGG   Corynebacterium diphtheriae HC01: CDHC01_2037Help
Entry
CDHC01_2037       CDS       T01693                                 

Definition
(GenBank) putative zinc-binding alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
cdt  Corynebacterium diphtheriae HC01
Pathway
cdt00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:cdt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CDHC01_2037
Enzymes [BR:cdt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     CDHC01_2037
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     CDHC01_2037
    1.1.1.-  
     CDHC01_2037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C AdoHcyase_NAD 2-Hacid_dh_C AlaDh_PNT_C NAD_binding_3 ADH_zinc_N_2 Pyr_redox FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AEX75278
Position
complement(2161321..2162412)
Genome map
AA seq 363 aa AA seqDB search
MKAARYYDQKDIRIEDISEQPLLPGTARIKVAWCGICGTDLHEFLEGPLFVPEHHHPHPV
SGEDSPVTLGHEMSGVITEVAEDVTDLAVGDHVVVEPYLIHDDVDTSEANPFYHLSRDMN
FIGLAGGGGGLSENIVVKRRWIHKISPDLPLDEAALIEPLSVGYHAVERSGFASEEAAKG
KVALVGGAGPIGLLTASVLKAFGATVVISELSPLRRKKALDSGAADYALNPAEVDVVEEI
AKLTDGKGADVAFECTSVQVVLDTLMDAVRPGAVIVVVSIWSKRSNFDIHKLVMKEIDLR
GTIAYSHAHPNTIKLVESGKINLKPFITGKIALQDIVDKGFDTLINHNETAVKILVSPSG
EGL
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcacggtactacgaccaaaaagacatccgaattgaagacatctccgagcag
ccactgctgccaggcactgcccgcatcaaagtagcgtggtgtggcatttgtggcaccgac
ttgcacgagttcctcgaaggtccactattcgtcccagaacaccaccacccgcacccagtc
tccggtgaggactccccagtgaccttggggcatgaaatgtccggcgtgatcacagaagtc
gccgaggacgtgaccgatctagccgttggcgaccacgtagtagtagagccctacttgatt
cacgatgatgtagacacttctgaagccaaccccttctaccatctttcccgcgacatgaac
ttcattggtcttgccggtggcggcggtggcttaagtgaaaacattgtggtcaagcggcgc
tggatccacaaaatctccccagacctgcctctcgacgaagcagccctcatcgaaccactg
tctgtgggctatcacgcagtggaacgttctgggttcgcctccgaagaagcagccaagggc
aaggttgcactcgtcggcggtgctggacctatcggcttgctcaccgcctcagtactcaag
gctttcggcgccaccgtggtgatatcagaactatccccgctgcgtaggaagaaggcactc
gattccggtgctgccgactacgctctcaacccagcagaagtggatgtggttgaagaaatt
gccaagcttaccgacggcaaaggtgccgacgtcgccttcgaatgcacctccgtccaagta
gtgctggacaccctcatggatgctgttcgcccaggggctgtgatcgttgtggtgtccatc
tggtctaagcgctccaactttgacatccacaagttggtgatgaaggagatcgacctgcgc
ggcacgattgcctactcccatgcacacccgaacaccatcaagctggtggaatccggaaag
attaacctcaaaccgtttatcaccggcaagattgcgcttcaagacatcgtggataaaggc
tttgacaccctcattaaccacaatgaaaccgcagtcaagatcttggtatccccatcgggc
gaaggcctctag

DBGET integrated database retrieval system