KEGG   Corynebacterium diphtheriae HC01: CDHC01_2089Help
Entry
CDHC01_2089       CDS       T01693                                 

Definition
(GenBank) putative integral membrane protein
  KO
K19302  undecaprenyl-diphosphatase [EC:3.6.1.27]
Organism
cdt  Corynebacterium diphtheriae HC01
Pathway
cdt00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:cdt00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CDHC01_2089
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cdt01011]
    CDHC01_2089
Enzymes [BR:cdt01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.27  undecaprenyl-diphosphate phosphatase
     CDHC01_2089
Peptidoglycan biosynthesis and degradation proteins [BR:cdt01011]
 Precursor biosynthesis
  Diphosphatase
   CDHC01_2089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PAP2 PAP2_3 PAP2_C
Motif
Other DBs
NCBI-ProteinID: AEX75330
Position
complement(2229054..2229539)
Genome map
AA seq 161 aa AA seqDB search
MISLRSEWLTALVVPFTLAFAPRYVLLYSALWSAWRARRTPPLQAVFPLLAVGFAVSLSP
VLKALIGRERPPIAEQLLYHFNPSMPSGHAVAAFALATVISYLSTRPWVQQLAWCVAVLV
ALSRLYVGVHWLSDVLVGGAIGVIAVWLIWSACRFNQPNSE
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgatctcgctacgttcggagtggttgaccgccctcgtcgtgcccttcactttggcattc
gcgccacgctacgtcctgttatattccgcactgtggtctgcgtggcgtgcccgccgtacc
ccaccgctacaagcagtatttccactgctagcggtgggttttgctgtatcacttagtccg
gtacttaaagcactcattggtcgcgaacgcccaccgatcgccgagcagctgctgtaccat
ttcaacccatcaatgccctctggtcatgcggtggcagcctttgctcttgccacggttatt
tcttatctctcaacgcgcccttgggtgcagcaattggcgtggtgtgtggcggtgctggtg
gcgcttagcaggctttatgtgggggtgcattggcttagcgacgtcctcgtgggtggcgcg
attggggttattgcggtgtggttaatttggtctgcttgccgcttcaatcagccgaattcg
gaataa

DBGET integrated database retrieval system