KEGG   Candida dubliniensis: CD36_00650
Entry
CD36_00650        CDS       T01140                                 

Definition
(RefSeq) calcineurin A1, putative
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
cdu  Candida dubliniensis
Brite
KEGG Orthology (KO) [BR:cdu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cdu01009]
    CD36_00650
Enzymes [BR:cdu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     CD36_00650
Protein phosphatases and associated proteins [BR:cdu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     CD36_00650
SSDB
Motif
Pfam: Metallophos ASD2 PPP5
Other DBs
NCBI-GeneID: 8045551
NCBI-ProteinID: XP_002416744
UniProt: B9W6M3
Position
1:complement(137377..139200)
AA seq 607 aa
MSGNTVQRNTEQINNALNAIQHRRTTTGNDLNHTNQRIISQNSINDKDYTIYITDDGEKY
STVERAVKSVDPPVTFKPKDEQVFLSNGKPNHQFLKQHFIHEGRLHEHQAIQILKQATHL
LSKESNLLNVPAPVTICGDVHGQYYDLMKLFEVGGDPATTKYLFLGDYVDRGSFSIECLL
YLYSLKINYPDTFWMLRGNHECRHLTEYFTFKNECLHKYSEQLYEECLVSFNALPLAAIM
NEQFFCVHGGLSPQLTSLDSLRKLHRFREPPTKGLMCDLLWADPIEEYDEDNIDQEYVTN
VVRGCSFAFTYKAACKFLDKTKLLSVIRAHEAQNAGYRMYKRTKTMGFPSLLTMFSAPNY
LDSYNNKAAVLKYENNVMNIRQFNASPHPYWLPHFMDVFTWSLPFVGEKVTDMLVSILNV
CTEEELDEDLPFSESEIGVATKTTKTTTPVSPVSPKAHPPSTRITSPYKSTKLVESDNNP
NTNNDDSEMTLEEKKQALRNKIIAIGKMSRMFQVLREEQENVAHLKELNRGSLPKGSLLH
GVDGLKNTINSFEEAKAADRINEALPPSPEDIQRLKQEKNTRIRQQIENQEMSGPVFQRL
IRRLSQS
NT seq 1824 nt   +upstreamnt  +downstreamnt
atgtcaggaaatactgttcaacgtaatactgaacaaatcaataatgcattaaatgctatt
caacatagacgaaccactactggtaatgatttaaatcatactaatcaacgaataattctg
caaaattcaataaatgataaagattatacaatttatattactgatgatggagaaaaatat
tctactgttgaaagagctgtgaaatcagttgatccaccagtaacatttaaacctaaagat
gaacaagtttttttatcaaatggtaaacctaatcatcaatttttaaaacaacattttatt
catgaaggtagattacatgaacatcaagccattcaaattttaaaacaagctactcattta
ttaagtaaagaatcaaatttattaaatgtcccagcaccagtaactatatgtggagatgtt
catggacaatattatgatttaatgaaattatttgaagttggtggtgatccagcaactact
aaatatttatttttaggtgattatgttgatcgaggttcattttctattgaatgtttactt
tatttatattcattaaaaattaattatcctgatactttttggatgcttagaggtaatcat
gaatgtcgtcatttaactgaatatttcacatttaaaaatgaatgtttacataaatattcg
gaacaattatatgaagaatgtcttgttagttttaatgctttacctttggcagcaattatg
aatgaacaatttttttgtgttcatggaggattatcaccacaattaacaagtttggatagt
cttagaaaattacatagatttagagaaccccctactaaagggttaatgtgtgatttatta
tgggctgatcctattgaagaatatgacgaagataatattgatcaagaatatgttactaat
gtggttagaggttgttcatttgcatttacttataaagctgcttgtaaatttttggataaa
acaaaattattatcggtaattcgagctcatgaagctcaaaatgctggttatcgaatgtat
aaaagaactaaaacaatgggattcccatcattattaactatgtttagtgctccaaattat
ttggatagttataataataaggcagctgtattaaaatatgaaaataatgtcatgaatatt
agacaatttaatgcttcacctcatccttattggttacctcattttatggatgttttcact
tggtctttaccatttgttggagaaaaagttactgatatgttggtttcaattttaaatgtt
tgtactgaagaagaattagatgaagatttaccatttagtgaatcagaaataggtgttgca
acaaaaacaacaaaaacaacaacaccagtgtcaccagtgtcaccaaaagctcatccacca
tcaactcgtattacatcaccttataaatcaactaaacttgttgaatcagacaataatcct
aacaccaataatgatgattcggaaatgacattggaagaaaagaaacaagctttacgtaac
aaaatcattgctattggtaaaatgtcacggatgtttcaagttttacgagaagaacaagaa
aatgttgctcatttaaaagaattaaatcgtggttcattaccaaaaggttcattattacat
ggagttgatggtttaaaaaatactattaattcatttgaagaagctaaagctgctgataga
attaatgaagctttaccaccttcaccagaagatatacaacgattaaaacaagaaaaaaat
accagaattagacaacaaattgaaaatcaagaaatgagtggaccagttttccaaagatta
attagaagattatctcaaagttga

DBGET integrated database retrieval system