KEGG   Candida dubliniensis: CD36_01530Help
Entry
CD36_01530        CDS       T01140                                 

Definition
(RefSeq) separase, putative
  KO
K02365  separase [EC:3.4.22.49]
Organism
cdu  Candida dubliniensis
Pathway
cdu04111  Cell cycle - yeast
cdu04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:cdu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    CD36_01530
   04113 Meiosis - yeast
    CD36_01530
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cdu01002]
    CD36_01530
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cdu03036]
    CD36_01530
Enzymes [BR:cdu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.49  separase
     CD36_01530
Peptidases and inhibitors [BR:cdu01002]
 Cysteine peptidases
  Family C50: separase family
   CD36_01530
Chromosome and associated proteins [BR:cdu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Separase
    CD36_01530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_C50
Motif
Other DBs
NCBI-GeneID: 8045554
NCBI-ProteinID: XP_002416830
UniProt: B9W6V9
Position
1:complement(350779..355569)
Genome map
AA seq 1596 aa AA seqDB search
MDNSLDQKLLAFISSQSTLKPLSPSKSNNLPKTDIKSLESLCVASLDTLLNNNGVSNSNS
SVLALDSLDAIEIRLRGLYLIYADDPRKSFDILRKHQLFIVKLFNLKQIHYVYQNLNVLF
DEINKLFMIEPMSKSTIFTGIEFTDFSNWNDETSFFNANRKDISQLIVAFHFLILQWIAQ
YVSKNLKSILMQKDQVIGLDEFCNIPRMFLNSSNFRKWQLLSVNENLVKYNSNNVKLISG
FIKVFQSIKASSSLLKYVNLTNCLRLKLCEFTKDKSLLKSIGFSSELIPFINDEDININE
FIHRHVPEISEVSNELQAQLLESPHLISDSDFLRNLQNDLQLSIDKCQIIISAFNTFKYN
LKSLSSQQLSILDLITIHLKDSLDESVIPILSQSFQIYNHFKLIKRMRNISNLLFNLGNK
SNNDIYRNLAVDYECVIFEISPSNDNFKQFYNKLTRTQVATSVFGKVLVCFESYMGLTNN
KDYDINGTLTQIICKTLLQISNYTPLNSIKDENFKFNVINDIFQFMEKSNNTTEKTKVCN
SIIESTTWSNQLIECKIYYQYYNVNGLEKYLDLEEKSCDNQLITSGLQFQRLVTFGWNET
LLIECLNNLKYGLNDNSAELDLFELKIIKQVLLYIKYNGMIDELVVIIEILLVKSIKHEQ
FEKFLLFEYARALLYQANNSTTNNDKFSQVFNDLKKLSQNWKSFDDIIELSLLQLQYFIH
TKNSTKAKDRFNGILQTLLKKPQFNISKSKNLPIVSKLQNFLILGRFQLLACQINNHIIH
NKIDAFNNIKTGIQLLYSIMKKLPTNIDKISWQELKWEITRLLFDSYKLAIDSSIDTGIS
RDIPLFLNEWVKLNNSIGNDIPIVNCINEFEIGQYGLLANNEFQKYIEIAENRLKHDLVG
KNNTVKQYINRYHDDESKKFERNDIIWKQSSSSHQLKSLVRSILNSDNSLSDVSKSVQLL
PCVVGESSTLCSKDLLDNLIQLKNETLMEITDSGKSRSLSLCQQQELIANMNQTVCLLSS
LTSFRGDGLLSEIYYLQDYVRNLPFSNERKLMNSLKNDESNDLLPRALDLSQFDDPSNNN
TIKSGGMIDFNVDLQLYLPNNWILVTLDICENTGDLLISKLTKGSPSPIFIRLPLSRFPS
SLDFKQLMHNFEKIIDESNLSTKKKTTSKILTVEDRKQWWRSRFTLDYQLQDILHHVETK
WFGGFISGIFTNNNNNNNNIENESNNGFIKFKQDLIKVLKDCLTVNDDKFNLEGFLQFNE
FIYYCFHSMEEYNYELVDDLIKFIITNMNSHGKIVNSDNNVKINKLHESIKNLIIKNNKN
KQNVVNNNCNSQHIVLIPNANCSNFPWESMDFLRNKSISRIPSIHMLLDLVKSKTNSKNK
SMTVDKSNLYYLINPSGDLIRSENRFKKIFESNYLWRGKIGQLSTNRNENYQDLILCEIL
KSHLFVYIGHGGCDQYIKVSKLLKKCGNDQDSQNKLPPSLLLGCSSVKLDNCNYNYNSSK
LQPSGNIYNWLNCKSAMILGNLWDVTDKDIDIFTISLLQKWGLINDSTNNNSNNNNNHGM
KKLDLTNSVVQSRGKCTLKYLNGSAPVVYGLPMYLN
NT seq 4791 nt NT seq  +upstreamnt  +downstreamnt
atggataactcattggatcaaaaactattggcgtttatatcatcacaatcaacactcaaa
ccattgtcaccaagcaaatcaaataacctccccaaaactgatataaaatcacttgaatca
ttgtgtgttgcatcattagacactcttttgaataataatggagtttctaatagcaatagt
agtgtcttggcattagactcgcttgatgctattgaaatacgattgcgtgggttgtatttg
atttatgctgatgacccgcggaagtcatttgatatactacggaaacatcaattatttatt
gttaaattatttaatcttaaacaaatccattatgtttatcaaaatctaaatgttttgttt
gatgaaattaataaattattcatgattgaacccatgtccaaaagtactatttttacaggt
atcgaatttactgatttcagtaattggaacgatgagacaagtttcttcaatgcaaacaga
aaagatatatcccaattgattgttgcctttcatttcttaattttacaatggatagcacaa
tatgtttccaagaatttaaagtcaatattaatgcaaaaggatcaggttatcggtctagat
gaattttgcaatatcccacgaatgtttttaaattccagtaattttagaaaatggcaatta
ttgagtgttaatgaaaacttggttaaatataacagtaataatgttaaattgatttctggg
tttataaaagtattccaaagtattaaagcgtcgtcgtccttattaaaatatgtcaatttg
actaattgtttgagattgaagttatgtgaatttacaaaagacaagtcgttattaaagtca
attggattttcctctgagttaattccattcatcaatgatgaggatataaatattaatgag
tttattcatagacatgtcccagaaatatctgaagtttccaatgaattgcaggctcagtta
ttagagtcaccacatcttatcagtgatagcgattttcttcgaaatctacagaatgattta
caattatcaatagataaatgtcaaataataatttcagcttttaatacatttaaatacaac
ctcaaatcactcctgagccaacaattgtcaattcttgatttaatcacaatacatttgaag
gattcattagatgaatcagtaattcccatattatctcaactgtttcaaatttataatcat
tttaaattaataaaaagaatgagaaacatttctaatttattattcaatttggggaacaaa
tcaaacaatgatatttatcggaacttggcagttgactatgaatgtgtaatatttgagatt
tctccaagtaatgacaactttaaacagttttataataaattgacaagaacacaagttgcc
acttcggtatttggcaaggttctagtgtgttttgaaagttatatgggcttgacaaacaat
aaggattatgatatcaatggaacgttaactcaaattatttgtaaaactttattacaaatt
tcaaattatactccattaaatagcatcaaagatgagaatttcaaatttaatgtgattaat
gatattttccaatttatggagaaatcaaataatacaactgaaaaaactaaagtttgcaat
tcaattattgaatccaccacttggagtaatcaattgattgaatgcaaaatatactatcaa
tactataacgtcaatggacttgaaaagtatttggatttggaggaaaaatcttgtgataat
caattaataacttctggtttacaatttcagagattggtaacatttggttggaatgaaact
ttattaatagaatgtttgaataatttaaagtatgggttaaatgataactccgcggaactt
gatttatttgaactaaagataattaagcaagtcttattatatataaaatataatgggatg
attgatgaattggttgttattattgaaattttactagtcaaatcaattaaacatgaacaa
tttgagaaatttcttttatttgaatatgcacgagcattattgtatcaagccaacaactca
accacaaataatgacaagttttcacaagtgttcaatgatttgaagaaactttcacagaat
tggaaatcatttgatgatattattgaattgagtttgttacaattacaatacttcatacat
accaagaattcaacgaaagcaaaagatagatttaatggaattttacaaacacttttgaaa
aaacctcaattcaatatatcaaaatcaaagaatttaccgattgtttccaaattacaaaac
tttttgattttaggaagatttcaattacttgcttgtcagatcaataatcatattatacat
aataaaatcgatgcctttaataatattaaaacagggattcaattattgtattcaattatg
aaaaaacttcctactaatattgacaaaatatcatggcaagaacttaaatgggaaattact
cgattattgtttgatagttataaattggcaattgattcatcaattgatactggaatatct
cgagacatccctttgtttttaaatgaatgggttaaactcaataacagtattggtaatgat
ataccgattgttaattgtattaatgaatttgaaattggtcaatatggattgcttgccaat
aatgaatttcaaaaatatattgaaattgctgaaaatagacttaaacatgatcttgttggg
aaaaataatactgttaaacaatacattaatagataccacgatgatgagtctaagaaattt
gaaagaaatgatattatttggaaacaatcgtctagtagtcatcaattaaagagtcttgtg
aggtctatccttaattcagataattcactcagtgacgtactgaaatcagtacaattattg
ccttgtgttgttggtgagagttccactttatgttctaaagatttacttgataatttaatt
caattaaaaaatgaaacattaatggaaataactgattctgggaaatctcgttcattatca
ttatgtcaacaacaagaactaattgctaatatgaatcaaactgtttgtttattgtcttct
ttgacttcgtttagaggtgatggtttgttatcggagatttattatcttcaagattatgtt
agaaatctaccattttctaatgaacgcaaattaatgaattctttgaagaatgatgagagt
aatgacttgttacctcgtgcattagacctcagtcaatttgacgatccaagtaacaacaac
actatcaagagtggtggtatgatagattttaatgttgatttacagctttatttacctaat
aattggattcttgttacattggatatttgtgagaatactggagatttattgatttccaaa
ttaaccaaaggatcaccaagtccaatttttataaggttgccattactgagatttccttca
agtttggatttcaaacaattgatgcataattttgaaaaaatcattgatgaaagtaattta
tcaacaaagaagaaaaccacatctaaaattttaactgttgaagatagaaagcaatggtgg
aggtctcgattcactttagattatcaattgcaagatattttacatcatgttgaaacaaaa
tggtttggtgggtttatttcaggtattttcaccaacaacaacaacaataataataatatt
gaaaatgaatcgaataatggatttattaaattcaaacaagatttaataaaagtcttaaaa
gattgtttaacagtaaatgatgataaattcaatttagaagggttccttcaatttaatgaa
tttatttattattgttttcattcaatggaagaatataattatgaattggttgatgatttg
ataaaatttattattacaaatatgaattctcatggtaaaattgttaattctgacaataat
gttaaaattaataaattgcacgaatcaattaagaacttgatcatcaaaaataataaaaat
aaacaaaatgtggtcaacaacaactgcaattcccaacacattgttttgattcctaatgca
aattgttctaatttcccatgggaatcaatggactttcttcgtaataaatcaatttcaaga
attccatcaattcatatgttacttgatctagtcaaatcaaaaaccaatagtaagaataaa
tctatgactgttgataaatcaaatttatattatttgattaatccaagtggtgatttaatt
cgatcagaaaatagatttaaaaaaatatttgaatcaaattatttatggagagggaaaatt
ggacaattatcaactaataggaatgaaaattatcaagatttgatattatgtgaaattttg
aaaagtcacttgtttgtttatattggtcatggaggttgtgatcaatatattaaagtgtca
aaattattgaaaaaatgtggtaatgatcaagattcacagaataagttacctccaagttta
ttattaggttgttcgtcagttaaattagataattgcaattataactataattctagtaag
ttacaaccactgggtaatatttataattggttgaattgtaaatcagcaatgatacttggg
aatttatgggatgttactgataaagatattgatatattcacgatttcattattgcaaaaa
tgggggttaataaatgattccacgaataataatagtaataataataataatcatggtatg
aaaaaattggatttgactaattctgttgttcaaagtagaggtaaatgtactttgaaatat
ttaaatggatcagcacctgtggtttatggtttaccaatgtatttaaattag

DBGET integrated database retrieval system