KEGG   Candida dubliniensis: CD36_02790Help
Entry
CD36_02790        CDS       T01140                                 

Definition
(RefSeq) exo-1,3-beta-glucanase I/II, putative
  KO
K01210  glucan 1,3-beta-glucosidase [EC:3.2.1.58]
Organism
cdu  Candida dubliniensis
Pathway
cdu00500  Starch and sucrose metabolism
cdu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CD36_02790
Enzymes [BR:cdu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.58  glucan 1,3-beta-glucosidase
     CD36_02790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cellulase
Motif
Other DBs
NCBI-GeneID: 8044487
NCBI-ProteinID: XP_002416951
UniProt: B9W780
Position
1:complement(642668..643984)
Genome map
AA seq 438 aa AA seqDB search
MQLSFILTSSVFILLLEFVKASVISNPFKPNGNLKFKRGGGHNVAWDYDKDVIRGVNLGG
WFVLEPYMTPSLFEPFQNGNDQSGVPVDEYHWTQTLGKDAAQSILQQHWSTWITEQDFKQ
ISDLGLNFVRIPIGYWAFQLLDNDPYVQGQVEYLEKALGWARNHNIKVWIDLHGAPGSQN
GFDNSGLRDSYNFQNGDNTKVTLNVLNTIFKKYGGNNYSDVVIGIELLNEPLGPVLNMDN
LKQFFLDGYNSLRQTGSVTPVIIHDAFQVFGYWDQFLTVAEGQWNVVVDHHHYQVFSGGE
LSRNINDHISVACNWGWDAKKESHWNVAGEWSAALTDCAKWLNGVNRGARYEGAYDNAPY
IGSCQPFLDISQWSDEHKTDTRRYIEAQLDAFEYTGGWVFWSWKTESAPEWSFQTLTYNG
LFPQPVTDRQFPNQCGFH
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgcagttatcattcatattaacatcatcggtatttatattgttgcttgaatttgtcaaa
gccctggttatttctaatccattcaaaccaaatggaaacttgaaattcaagagaggaggt
ggtcataacgttgcttgggattatgacaaggatgttatcagaggtgtcaatttgggtggt
tggtttgtccttgaaccatatatgacaccatcgctttttgaaccattccaaaacgggaat
gatcaatctggtgttccagttgatgaatatcactggacacaaactttgggcaaagatgct
gctcagtccattttgcagcaacattggagtacttggatcacggaacaagactttaaacaa
attagtgatttgggattgaactttgttcgtattcctattggttattgggccttccaattg
ttggataatgatccatatgttcaaggtcaagttgagtatttggagaaggccttgggttgg
gccagaaatcacaatatcaaagtttggattgatttgcacggtgcaccaggctctcaaaat
gggtttgacaactccggattgagagatagttacaatttccaaaacggtgacaacaccaaa
gttactttgaatgtattgaatactattttcaaaaagtatggtggcaataactactcagac
gttgttatcggtattgaattgctcaacgagccattgggaccagtcttgaacatggataac
ttgaaacaatttttcttggatggctacaattctcttagacaaactggatcagttacccca
gttattattcacgatgctttccaagtgtttggctattgggatcaatttttgactgttgca
gaaggtcaatggaatgttgttgttgaccatcatcattatcaagtgttctctggtggtgaa
ttatctcgtaacattaacgaccacatttcagtcgcttgtaattggggttgggatgctaag
aaggaatcccattggaacgttgccggagaatggtctgctgctttgacagattgtgctaaa
tggttgaatggtgttaacagaggagctcgttatgaaggtgcttacgataatgctccatac
attggatcttgtcaacccttcttggatatttcccaatggtccgatgaacacaaaactgac
acgagaagatacattgaagctcaattggatgcttttgaatacactggaggctgggtcttc
tggagttggaaaactgaaagtgctcctgaatggagtttccaaactttgacttacaatggt
cttttcccacaaccagtcactgatagacaattcccaaaccaatgtggttttcactga

DBGET integrated database retrieval system