KEGG   Candida dubliniensis: CD36_03790Help
Entry
CD36_03790        CDS       T01140                                 

Definition
(RefSeq) aspartyl-tRNA synthetase, mitochondrial
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
cdu  Candida dubliniensis
Pathway
cdu00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:cdu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CD36_03790
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cdu01007]
    CD36_03790
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cdu03016]
    CD36_03790
   03029 Mitochondrial biogenesis [BR:cdu03029]
    CD36_03790
Enzymes [BR:cdu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     CD36_03790
Amino acid related enzymes [BR:cdu01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   CD36_03790
Transfer RNA biogenesis [BR:cdu03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CD36_03790
 Prokaryotic Type
   Other AARSs
    CD36_03790
Mitochondrial biogenesis [BR:cdu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CD36_03790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 tRNA_anti-codon tRNA-synt_2d
Motif
Other DBs
NCBI-GeneID: 8044585
NCBI-ProteinID: XP_002417049
UniProt: B9W7H8
Position
1:876051..878102
Genome map
AA seq 683 aa AA seqDB search
MLKILSKIQQNGVRYISTLPDKASTLAKFDFPLATHTIKSIDSNIENYLNKQQTKVTLNG
HVHRKSRIRPALGFAFLRDTNGDEIQLLATPKYTEPSIFELMKKLTVEDSVSVTGFVQPK
ESKMGKDQQWELVVEDFQILNSSNLDAAQLDKLKHNSPQNIPPQFRYLQLRTPYYQKSLR
LRSEAAKVIRNIFIENHDFVEIETPLLFKSTPEGAREFLVPTRSFNKFYALPQSPQQYKQ
ILMSSGFTRYFQVAKCFRDEDLRSDRQPEFTQIDLEMSFVNNSDQVGIVVEDVIHNVWNK
VGGKPTYKVNDEGFLEKVDLAEAGKSLQFNKLNYIDALVKYGIDKPDLRSNLSFISLEDI
FVAKENADFPVVEVCVLKEAFDASSGKYKLPKTFIDDHNFSSRRPYVWAIQKNDDTFSYF
KKLIDANIIATTDKFDESKLQELLNLQPGDILAVSTRAQFPYENPTPLGKFRQLAIEEFP
HKWQRPIIENGQLSVDYDRNDMVVGSWVVNFPLFNPVEESSLISSATQENLKPKYPLYNF
KKFESTHHPFTMAKIEDYDLLETNPLKVHGEHYDLVINGVEVGGGSRRIHDPALQQYIFE
EILQISNFQQLFGHLLKALSMGCPPHAGLALGFDRLCAMLVGSPSIRDVIAFPKNQSGVD
PVVESPTGVKEATLNEYFITTKI
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaaatactatcgaaaatacaacaaaatggtgttagatacatttccaccctccct
gataaagcatcaactttagcaaaatttgatttccccttagctactcataccataaaatca
atcgattccaatattgaaaactatttaaataaacaacaaactaaagtaacattaaatgga
catgtacatagaaagtcaagaataaggcctgctttaggatttgcatttttaagagatacc
aatggtgatgaaatccaattgttggcaactccgaaatataccgaaccatctatatttgaa
ttgatgaaaaaattgactgtggaagattctgttagtgtgactggttttgttcaacctaaa
gaatccaaaatgggtaaagatcaacaatgggaattggttgtggaagatttccaaatatta
aattcatctaatttagatgctgcccaattagataaattgaaacataatagtcctcagaat
atccctcctcaatttagatatttacaattaagaacaccatactatcaaaagtctttaaga
ttaaggagtgaagcagcaaaagttattcgaaacatatttattgaaaaccatgattttgtt
gaaattgaaactccattattattcaagtcaactccggagggggcacgagaatttttggtt
ccaacaagatcttttaataaattttatgcattaccacaatcacctcaacaatataaacaa
atcttgatgagttctgggtttactcgatatttccaagttgctaaatgttttagagatgaa
gatttacgatcagacagacaacctgaattcactcaaattgatttggaaatgagttttgta
aataattctgatcaagttggaattgttgtggaggatgtgattcataatgtttggaataaa
gttggtggtaaaccaacttataaagtcaatgatgaaggatttttggaaaaagttgatctt
gctgaggctggtaaatctttacaatttaataaattaaactatattgatgccttggtgaaa
tatggaattgacaaacctgatttaagatcaaacttgtcattcataagtcttgaagatatt
tttgttgctaaagaaaatgctgatttcccagttgtcgaagtttgtgttttgaaggaagct
tttgatgcttcttccgggaaatataagttacctaaaacttttattgatgatcataacttt
tcatctagaagaccttatgtatgggcaatacaaaagaacgatgatacattcagttatttc
aagaaattgattgatgcaaatattatagctactacagacaaatttgatgaaagtaaattg
caagaattgttaaatttacaaccaggtgatattcttgctgtatctacaagagcacagttc
ccatatgaaaatccaacgccattaggtaaattcagacagttggcaatagaagaattccca
cataaatggcagcgtcctattattgaaaatggccaattaagcgttgattatgatcgcaat
gatatggttgttggatcttgggttgttaatttcccattatttaacccagtggaagaatct
tcactaatttctagtgccactcaagaaaacttgaaaccaaaatacccactttataatttt
aaaaaatttgaatccacacatcatccattcactatggccaagattgaagattacgatttg
ctagagactaatcctttgaaggttcatggtgaacattatgatttggtcataaatggagtt
gaagttggtggtggttcaagaagaatacacgatcctgcattgcaacaatacatttttgaa
gagattttgcaaatttcaaatttccaacaattgtttggtcatttattgaaagcattgagt
atgggttgtccaccacatgctggtttggcattaggattcgatagattgtgtgccatgtta
gtaggatcccccagtattagagatgtaatagcatttccaaagaatcaatcaggagttgat
ccagtagtagagagtcctacgggagtcaaagaggcaacacttaatgaatactttataact
acaaagatctag

DBGET integrated database retrieval system