KEGG   Candida dubliniensis: CD36_03940Help
Entry
CD36_03940        CDS       T01140                                 

Definition
(RefSeq) histone H2B, putative
  KO
K11252  histone H2B
Organism
cdu  Candida dubliniensis
Brite
Chromosome and associated proteins [BR:cdu03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    CD36_03940
Exosome [BR:cdu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CD36_03940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like CENP-W
Motif
Other DBs
NCBI-GeneID: 8044600
NCBI-ProteinID: XP_002417064
UniProt: B9W7J3
Position
1:901024..901416
Genome map
AA seq 130 aa AA seqDB search
MAPKAEKKPASKAPAEKKPAAKKTASTDGAKKRTKTRKETYSSYIYKVLKQTHPDTGISQ
KAMSIMNSFVNDIFERIASEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTR
AVTKYSSASN
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atggctccaaaagcagaaaagaaaccagcttctaaagctccagctgaaaagaaaccagct
gctaaaaaaaccgcttcaactgatggtgctaaaaagagaactaaaactagaaaagaaact
tattcttcatatatttataaagtcttaaaacaaactcatccagatactggtatttctcaa
aaagctatgtctattatgaattcatttgttaatgatatttttgaaagaattgcttctgaa
gcttctaaattggctgcttataataaaaaatctaccatttctgctagagaaattcaaact
gctgttagattgatcttaccaggtgaattggctaaacatgctgtttctgaaggtactaga
gctgttactaaatactcttctgcttctaattag

DBGET integrated database retrieval system