KEGG   Candida dubliniensis: CD36_04050Help
Entry
CD36_04050        CDS       T01140                                 

Definition
(RefSeq) heat shock protein, putative
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
cdu  Candida dubliniensis
Pathway
cdu03040  Spliceosome
cdu04141  Protein processing in endoplasmic reticulum
cdu04144  Endocytosis
cdu04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:cdu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    CD36_04050
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CD36_04050
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    CD36_04050
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    CD36_04050
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cdu01009]
    CD36_04050
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cdu03041]
    CD36_04050
   03009 Ribosome biogenesis [BR:cdu03009]
    CD36_04050
   03110 Chaperones and folding catalysts [BR:cdu03110]
    CD36_04050
   04131 Membrane trafficking [BR:cdu04131]
    CD36_04050
   03051 Proteasome [BR:cdu03051]
    CD36_04050
   03029 Mitochondrial biogenesis [BR:cdu03029]
    CD36_04050
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cdu04147]
    CD36_04050
Protein phosphatases and associated proteins [BR:cdu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     CD36_04050
Spliceosome [BR:cdu03041]
 Complex B
  Other components
   Prp19 complex
    CD36_04050
 Complex C
   Prp19-CDC5 complex
    CD36_04050
Ribosome biogenesis [BR:cdu03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    CD36_04050
Chaperones and folding catalysts [BR:cdu03110]
 Heat shock proteins
  HSP70 / DNAK
   CD36_04050
Membrane trafficking [BR:cdu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    CD36_04050
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    CD36_04050
Proteasome [BR:cdu03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    CD36_04050
Mitochondrial biogenesis [BR:cdu03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    CD36_04050
Exosome [BR:cdu04147]
 Exosomal proteins
  Proteins found in most exosomes
   CD36_04050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A DDR PMBR Golgin_A5
Motif
Other DBs
NCBI-GeneID: 8044612
NCBI-ProteinID: XP_002417075
UniProt: B9W7K4
Position
1:complement(919866..921809)
Genome map
AA seq 647 aa AA seqDB search
MSKAVGIDLGTTYSCVAHFANDRVEIIANDQGNRTTPSFVAFTDTERLIGDAAKNQAAMN
PANTVFDAKRLIGRKFDDHEVQGDIKHFPFKVVDKGSKPMIQVEYKGETKTFSPEEISSM
ILGKMKETAEGFLGTTVKDAVVTVPAYFNDSQRQATKDAGTIAGLNVMRIINEPTAAAIA
YGLDKKSEAEKNVLIFDLGGGTFDVSLLSIEDGIFEVKATAGDTHLGGEDFDNRLVNFFI
QEFKRKNKKDISTNQRALRRLRTACERAKRTLSSSAQTSIEIDSLYEGIDFYTSITRARF
EELCADLFRSTLEPVDKVLSDAKIDKSKVDEIVLVGGSTRIPKVQKLVSDYFNGKEPNRS
INPDEAVAYGAAVQAAILSGDTSSKTQDLLLLDVAPLSLGIETAGGIMTKLIPRNSTIPT
KKSETFSTYADNQPGVLIQVFEGERAQTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDA
NGILNVSALEKGTGKTQKITITNDKGRLSKEEIEKMVSEAEKFKEEDEKEASRVQAKNQL
ESYAYSLKNTLSEEQFKSKLDASEIEEVTKAADETISWLDSNQTATQEEFADQQKELESK
ANPIMTKAYQAGATPSGAAPGGAAPGGFPGGAAPEPSNDGPTVEEVD
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagctgttggtattgatttaggtactacctactcctgtgtcgctcatttcgct
aatgatagagtcgaaattattgctaatgaccaaggtaacagaactacaccatctttcgtt
gccttcaccgatactgaaagattgattggtgatgctgctaaaaatcaagctgctatgaac
ccagctaacactgttttcgatgccaaacgtttaattggtagaaaattcgatgatcatgaa
gttcaaggtgatatcaaacatttcccattcaaagtcgttgacaaaggtagtaaaccaatg
attcaagttgaatacaaaggtgaaaccaaaactttctcccctgaagaaatctcatctatg
attttgggtaaaatgaaggaaactgctgaaggtttcttgggtaccactgttaaagatgct
gttgtcactgttccagcttacttcaatgattcccaaagacaagctaccaaagatgctggt
accattgctggtttaaatgttatgagaatcattaacgaaccaaccgctgctgccattgct
tacggtttggacaagaaatctgaagctgaaaagaatgttttgattttcgatttgggtggt
ggtacttttgatgtttcattattgtctattgaagatggtatttttgaagttaaagccact
gctggtgatactcatttgggtggtgaagattttgataacagattagtcaacttctttatc
caagaattcaagagaaaaaacaagaaagatatctccactaaccaaagagctttaagaaga
ttgagaactgcttgtgaaagagccaagagaactttatcttcttctgctcaaacctcaatt
gaaattgattctttatatgaaggtattgatttctatacttcaatcaccagagctagattc
gaagaattgtgtgctgacttgttcagatctactttggaaccagttgacaaagtcttgtct
gatgccaagattgataaatctaaagttgatgaaattgttttggttggtggttctaccaga
attccaaaagttcaaaaattagtttctgattactttaacggtaaagaaccaaacagatca
atcaacccagatgaagctgttgcttatggtgctgctgtccaagctgccatcttgtctggt
gacacttcttccaagactcaagacttgttgttgttggatgttgctccattgtcattaggt
attgaaactgctggtggtatcatgaccaaattgattccaagaaactccactattccaact
aagaaatccgaaactttctccacttatgctgacaaccaaccaggtgtattgattcaagtg
tttgaaggtgaaagagctcaaactaaagacaacaacttgttgggtaaatttgaattatct
ggtattccaccagctccaagaggtgttccacaaattgaagtcacatttgatattgatgct
aatggtattttgaatgtttctgctttagaaaaaggtactggtaaaactcaaaagattact
attactaatgataaaggtagattatctaaagaagaaattgagaaaatggttagtgaagct
gaaaaattcaaagaagaagatgaaaaagaagcttctagagttcaagccaaaaatcaattg
gaatcttatgcttattctttgaaaaatactttaagtgaagaacaatttaaatctaaattg
gatgcttcagaaattgaagaagtcactaaagcagctgatgaaactatttcttggttagat
tccaatcaaactgctactcaagaagaatttgctgatcaacaaaaagaattagaatctaaa
gctaatccaatcatgactaaagcttatcaagctggtgctactccttctggtgctgctcca
ggtggtgctgctccaggtggtttcccaggtggtgctgccccagaaccatctaacgatggt
ccaactgttgaagaagttgattag

DBGET integrated database retrieval system