KEGG   Candida dubliniensis: CD36_16510Help
Entry
CD36_16510        CDS       T01140                                 

Definition
(RefSeq) N6-adenosine-methyltransferase, putative
  KO
K05925  mRNA m6A methyltransferase [EC:2.1.1.348]
Organism
cdu  Candida dubliniensis
Brite
KEGG Orthology (KO) [BR:cdu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cdu03019]
    CD36_16510
Enzymes [BR:cdu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.348  mRNA m6A methyltransferase
     CD36_16510
Messenger RNA biogenesis [BR:cdu03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    N6-methyltransferase complex
     CD36_16510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MT-A70 Glyco_hydro_30
Motif
Other DBs
NCBI-GeneID: 8045698
NCBI-ProteinID: XP_002418131
UniProt: B9WAL1
Position
2:300016..301656
Genome map
AA seq 546 aa AA seqDB search
MIYELKDFIPFIEFILNQDNKILDTPIYGQLWIIGPLIQESSNLKFTTTKDFLDYIIQFN
TISGYSLEFSGDLNNSINIKHLPRLACINFEGILMLQKRLKGKQTFSQIPNSKNRNPPTN
LLQILEISSKHEMLPYSSTNNDSSNFSSELSLGVEFLQELINKPTARTILNKQKARLRTI
EKPFHSICNDHNHINLLATVGLNKKEYSHFGSKQTTPVDVVRQRILKCRNILSNDVYKCA
QDKIHFLPIINNHTDLNLGDCSYLDTCHKLKSCRYLHYYTLAPMKKEQSQVSEGQQQQQQ
QQRQIKLQGLEYTSGDCFSESFREPLPPQWINCDVRCLPFSILGKFAAIISDPAWDIHMS
LPYGTCKDDELLSLPMHELQDEGIIMLWVTGRSIEIGRRALLKWGYQIYDEMIWIKLNQL
RRTIVTGRTGHWLNHSKEHLLVGLKGNPTWINKKIDTDVVVSPTRETSRKPDEFYDIVER
LVGTHSRKLEIFGRDHNTRPGWLTIGNQLQGVSLFEPELKYKYELYKQTTTGATAATTTS
SGGGGK
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgatttatgaattaaaagactttattccatttattgagtttattttgaatcaagacaat
aagatattagacacaccaatatatggtcaactttggataattggacccttaattcaagag
tccagtaacttaaaatttaccacaactaaagactttttggattacattattcaattcaat
acgattagtggctacctgttagagtttagtggagatttaaataacagtattaatattaaa
cacttgccaagattagcatgtattaactttgagggaatcttaatgttgcaaaaaagattg
aaggggaaacaaacattttcacaaatacccaactccaagaatcgtaacccaccaactaac
ttattacagattttggaaattctgtcaaagcatgaaatgttaccgtattcctccaccaac
aatgatagtagtaacttttctagtgaattgtcacttggtgttgagtttttacaagagttg
attaataaacccaccgctagaacaattttgaataaacaaaaggcacggttaagaacaata
gaaaaacctttccattcaatttgcaatgaccataatcatatcaatttgctagctactgtt
gggttgaacaaaaaagaatatagtcattttggctctaaacaaacaacacctgtagatgtt
gttcgtcaaagaatactcaagtgtagaaacattttatcaaatgatgtatacaaatgtgct
caagataaaattcattttttacctattattaataatcatacagatttgaatttaggagat
tgttcctatttggatacttgccataaattgaaatcttgccgttatttgcattattataca
cttgctcctatgaaaaaagaacagtcacaagttagcgaaggacaacagcagcaacaacaa
caacaaagacaaataaaattacaaggacttgaatacactagtggagactgtttttcagaa
tctttcagagaaccattacctcctcaatggattaattgtgacgtgagatgcttgccattt
tcaatattaggcaagtttgcagctattatttctgatccagcatgggatatacacatgtca
ttgccgtatggtacttgcaaagacgatgagttattatctttacctatgcatgaattacaa
gatgagggtatcattatgttgtgggtaactggaaggtccattgaaatcgggagacgagca
ttgttgaaatggggatatcaaatctatgatgaaatgatttggatcaagttaaaccaattg
agaagaacgattgtcactggtagaaccggacactggttaaatcactccaaagaacattta
ttggttggacttaaaggaaatccaacctggattaataagaaaatcgataccgatgttgtt
gttagtcccactcgtgaaacatcaagaaaacctgatgaattttacgatattgtggaaaga
ttagtgggtactcattcaagaaaattagagatatttggtagagaccataatactagacca
ggatggcttacaattggaaatcaattacaaggggtttcattatttgaaccagaactcaaa
tataagtacgaattatataaacaaacaacaacgggtgcaactgctgctactactactagc
agtggtggtggcggaaaatga

DBGET integrated database retrieval system