KEGG   Candida dubliniensis: CD36_23520
Entry
CD36_23520        CDS       T01140                                 

Definition
(RefSeq) C-14 sterol reductase, putative
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
cdu  Candida dubliniensis
Pathway
cdu00100  Steroid biosynthesis
cdu01100  Metabolic pathways
cdu01110  Biosynthesis of secondary metabolites
Module
cdu_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:cdu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    CD36_23520
Enzymes [BR:cdu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     CD36_23520
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 DUF2189
Other DBs
NCBI-GeneID: 8046363
NCBI-ProteinID: XP_002418826
UniProt: B9WCK9
Position
2:complement(1929888..1931234)
AA seq 448 aa
MKSSKLNPVTTHKEFNGISGALGITIGLPSLIVLFYLLCNQTYSIQGISVDFSKITNQLP
TTQDELWQLVFNKTCWLAYLAWFFILVILDYLLPGKSLDGVKLRDGTVLNYKINGLSMSS
LLIVLLLARLFQSNKDSTSEYYLPELQFIYDNQLQLIIICFLFSFMLAVFVYIISFIPLA
KPNGIGTRERILSINGNTGNAFYDWFIGRELNPRIGSWDIKLFCELRPGMLLWLLINLSC
LHYQYHNLGYVTDSMVVVNLLQAFYIFDGVLNEEGCLTMIDITTDGFGFMLSFGDLAWVP
WTYSLQARYLSIKGNEINLGWTLSLLIIGLQALGFYIFRSANKQKSDFRQGKLPHLKSIQ
TKTGSKLLVEGWWGLSQHINYLGDWLIGLSWCLPTGFQTPLTYFYVIYFASLLIHRQIRD
EMKCRAKYGEDWQKYEKLVPYKIIPYVY
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgaaatcatcaaaattgaatccagtcacaactcataaagagttcaatggtatttctggg
gcattaggtataacaattggattgccttcactcattgtattgttttatttattgtgcaac
caaacatattccattcaaggaattagtgtcgatttctccaaaataacaaatcaattgcca
actactcaggatgaattatggcagctagtgttcaataaaacttgttggttggcatattta
gcttggttttttattttggtcattttggattatttgttgccaggcaagtcattagatggg
gtgaagttaagagatggcactgttttaaattataaaatcaatggcttaagcatgagctct
ttattaattgttttgctattggctcggttattccaactgaacaaagacagcacttctgaa
tattacttgcctgaattgcaatttatttatgacaaccaattacaattgatcattatttgc
tttttgttttcttttatgttagccgtgtttgtatatataatttcgtttatcccgttagct
aagccaaatggaattggtacaagagaaagaattttgagtatcaatggcaataccggcaat
gcattttatgattggttcattggtcgtgaattgaacccaaggataggtagttgggatata
aagttgttttgtgagttacgtcctggaatgttattatggttgttgataaatttgagctgt
ttgcattatcagtaccataatttgggctatgtaacagattcaatggttgttgtgaattta
cttcaagcattttacatcttcgatggggtgttgaacgaagaaggttgtttgacaatgatt
gatatcaccaccgacggatttggtttcatgttgagttttggtgacttggcttgggttcca
tggacttattctttacaggcaagatatttgagcataaaaggtaatgaaatcaatctagga
tggacgttaagtttgttaatcattggattacaagcattaggattttacattttccgttca
gcaaataaacaaaaatcagactttagacaaggtaaattgccacatttgaaaagcatccaa
accaaaactggctcaaaattgttggtggaaggctggtggggattatctcaacacattaat
tatttgggcgattggttgattggactatcttggtgtttgcctactggtttccaaactccc
ttgacttacttttacgtcatttactttgcttccttgttgatccatcgtcaaattagagat
gaaatgaaatgcagagcaaaatacggcgaagactggcaaaaatacgaaaaactagttcct
tataaaataattccttacgtatattaa

DBGET integrated database retrieval system