KEGG   Candida dubliniensis: CD36_24150Help
Entry
CD36_24150        CDS       T01140                                 

Gene name
CYC1
Definition
(RefSeq) cytochrome c iso-1, putative
  KO
K08738  cytochrome c
Organism
cdu  Candida dubliniensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 8046420
NCBI-ProteinID: XP_002418889
UniProt: B9WCS2
Position
2:2100822..2101154
Genome map
AA seq 110 aa AA seqDB search
MPAPYEKGSEKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGVFGRKSGLAEGYSYTDANK
KKGVEWSEQTMSDYLENPKKYIPGTKMAFGGLKKPKDRNDLVTYLKKATS
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgccagctccatacgaaaaaggttcagaaaagaaaggtgctactttattcaaaactaga
tgtttacaatgtcataccgttgaaaaaggtggtccacataaagttggtccaaatttacat
ggtgttttcggtagaaaatccggtttagctgaaggttattcttatactgatgctaataaa
aagaaaggagttgaatggtctgaacaaaccatgagtgattatttagaaaacccaaagaaa
tatattcctggtactaaaatggcttttggtggtttaaaaaaaccaaaggatagaaatgat
ttagttacttatttaaagaaagctacttcttaa

DBGET integrated database retrieval system