KEGG   Candida dubliniensis: CD36_24180Help
Entry
CD36_24180        CDS       T01140                                 

Definition
(RefSeq) deubiquitinating enzyme, putative
  KO
K11366  ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
cdu  Candida dubliniensis
Brite
Enzymes [BR:cdu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CD36_24180
Peptidases [BR:cdu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CD36_24180
Transcription machinery [BR:cdu03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     CD36_24180
Ubiquitin system [BR:cdu04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    CD36_24180
Chromosome and associated proteins [BR:cdu03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    SAGA complex
     CD36_24180
    SLIK complex
     CD36_24180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UCH UCH_1 zf-UBP
Motif
Other DBs
NCBI-GeneID: 8046422
NCBI-ProteinID: XP_002418892
UniProt: B9WCS5
Position
2:2106965..2108710
Genome map
AA seq 581 aa AA seqDB search
MPSDETISKSNGNINTATNNIPTTTTTTAAITQQQDGQDILEDQSTLFYNKLNFVRELTP
RPDNYSTINSCNHIDSVLRSKAKTTVFETYRQAVLISQPLIKSYKLKKDGSIIPIKKLIM
SKISALKCSQCHLNNFNNSMICLQCPHVGCCFNDYNHSYSHYKSTKHMFSIDSSCGLLYC
FKCNDFINHPELEKIRLQIILGDDDNIENINDKNNKDMNNFIKQNYVDPGKIAIKGLKGF
INLGATCFMSSILQTLIHNPLIKYQFFNNDLHYFNCEKIHNQFINNGNIDENNACITCSI
DNIFQSFYTSTTNEGFGMTNLLTTAWYKQKSLAGFEEQDAHEFWQFLLNEFHMDYQRIIM
NLKNEKLSNISKNDGLESVINSNSCGCIMHSTFSFELQSCIKCNSCESITETVDPMIDLS
LEVNFTNLYQSLQSFTRDEKLDDYNCKNCNTTTTTTNNNNNGNSKTSAIKKLRLKTLPQI
LSIQLKRFRHDTLGSFQATKIQSHIDFPLFLNVTEYSVINDTDYIYQLFAVVVHQGSINT
GHYTVFIKNNGNWYKFDDSVVTMVSQDDVINSEAYLLYYIV
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgccttctgatgaaacaatatctaaatcgaatggcaatatcaatactgccaccaataat
attcctactactactactactactgctgccattacacagcaacaagacggacaagacata
ctagaggatcaatcgacattattttataataaattgaattttgttcgagaattaacacct
cgacccgataattattccacaattaattcatgtaatcatattgattcagtcttaagatcc
aaagctaaaaccactgtatttgaaacttatagacaagcagtattaatatctcaaccatta
attaaatcatataaattgaaaaaagatggatcaattataccgattaaaaaattaattatg
tcgaaaatatcagcattaaaatgtagtcaatgtcatttaaataattttaataattcaatg
atttgtttacaatgtcctcatgttggttgttgttttaatgattataatcattcttattcc
cattataaatcaactaaacatatgttttctattgattcaagttgtggattattatattgt
tttaaatgtaatgattttattaatcaccctgaattagaaaaaattcgattacaaattatt
cttggtgatgatgataatattgaaaatattaatgataaaaataataaagatatgaataat
tttattaaacaaaattatgttgatccaggaaaaattgctataaaaggattaaaaggattt
attaatttaggagcaacatgttttatgagttcaattttacaaactttaattcataatcca
ttaattaaatatcaattttttaataatgatttacattattttaattgtgaaaaaattcat
aatcaatttattaataatgggaatattgatgaaaataatgcatgtataacatgtagtatt
gataatattttccaatcattttatacatcaactactaatgaaggatttggtatgactaat
ttattaactactgcttggtataaacaaaaatcattagcaggatttgaagaacaagatgct
catgaattttggcaatttttattaaatgaatttcatatggattatcaaagaattataatg
aatttaaaaaatgaaaaattgtcaaatatatccaaaaatgatggattagaatcagtgata
aattcaaattcttgtggatgtattatgcattcaacattttcatttgaattacaaagttgt
attaaatgtaattcttgtgaatcaattactgaaactgttgatccaatgattgatttatca
ttagaagtcaattttacaaatttatatcaatctttacaatcatttactagagatgaaaaa
ttagatgattataattgtaaaaattgtaacaccaccaccaccaccaccaacaataacaat
aacggtaattcaaaaacttcagcaattaaaaaattacgattgaaaactttaccacaaata
ttatcaattcaattgaagagatttagacatgatacattaggtagtttccaagcaacaaaa
attcaatctcacatagatttcccattatttttaaatgttacagaatattcagttattaat
gataccgattatatttatcaattatttgcagttgttgttcatcaaggatcaattaatact
ggtcattatacagtatttataaaaaataatggtaattggtataaatttgatgatagtgta
gttaccatggtttctcaagatgatgttatcaattccgaagcatacttattatactatata
gtttaa

DBGET integrated database retrieval system