KEGG   Candida dubliniensis: CD36_24690
Entry
CD36_24690        CDS       T01140                                 
Name
(RefSeq) ubiquitin domain-containing protein, putative
  KO
K04523  ubiquilin
Organism
cdu  Candida dubliniensis
Pathway
cdu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cdu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CD36_24690
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cdu04131]
    CD36_24690
   03051 Proteasome [BR:cdu03051]
    CD36_24690
Membrane trafficking [BR:cdu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    CD36_24690
Proteasome [BR:cdu03051]
 Eukaryotic proteasome
  Proteasome interacting proteins (PIPs)
   UBL-UBA shuttle proteins
    CD36_24690
SSDB
Motif
Pfam: ubiquitin Rad60-SLD UBA Rad60-SLD_2 Dsc3_N Ubiquitin_2 TBK1_ULD GerD HOIP-UBA XPC-binding YukD UN_NPL4 L27_2
Other DBs
NCBI-GeneID: 8046470
NCBI-ProteinID: XP_002418942
UniProt: B9WCX5
Position
2:complement(2250853..2251830)
AA seq 325 aa
MSESITITIKSSGDKKYEVTVDPSITVSQLKELVAEKSDIPAGSQRLIYSGKVLKDTETV
ASYKVQTGHTIHLVKSAATTAAAAAAAPQSSNTPANASVPSNIAAGQGSFNPLADLTGAR
YAGYSQLPSASMFGPDGGMNSNIPDPEQLNSMMSNPVFQQQMQAMLSDPQMLDFMIQQNP
QLRAMGPQVREMLQSPLFRQMMSNPEMLRSMMQMRGGDAGQTNAFPAPGANPTTGESGNN
GAPANPFANLFPNGIPPIDPSALFGGAAPAAAPAPVDNRPPEERYESQLRQLNDMGFYDF
DRNVEALRRTGGSVQGAIEYLLGGN
NT seq 978 nt   +upstreamnt  +downstreamnt
atgtctgaatcaatcactattaccatcaaatcgtctggcgataaaaaatacgaagtcaca
gttgatccactgatcactgtttcccagttaaaggagttggtcgcggaaaagtctgacata
cctgctggtagtcaaagattgatctactcaggaaaggtattgaaggatactgaaaccgtt
gcatcttacaaggtgcaaaccggacacactatccacttggttaaaagtgctgccaccact
gcagctgctgctgctgctgcaccacagctgtcaaacaccccagctaatgcttcagttcct
tcaaacatagcagcaggccaaggatcattcaacccactagctgacttaactggagcacgt
tatgctggatacagccaattaccatcggcatccatgtttggacctgatgggggtatgaac
agcaacataccggaccctgagcagttaaattccatgatgtcaaatcctgttttccaacaa
caaatgcaagcaatgttatcagatcctcaaatgctagattttatgatccaacagaatcct
caattgagagccatgggtcctcaagtcagagaaatgttacaaagtccattatttagacaa
atgatgtcgaacccggaaatgctaagaagtatgatgcaaatgagaggaggtgatgcgggg
caaactaatgcattccctgccccaggtgccaatcctactactggcgaaagtggcaataat
ggagcacctgctaacccatttgcaaatttgtttcctaatggaattccaccaattgatcct
ctggcattatttggaggtgctgcccctgcagccgcgcctgctccagtagacaacagacca
ccagaagaaagatatgaaagtcaattgagacaattgaacgatatggggttttatgatttc
gataggaatgtagaagcattaagaagaactggtggtagtgttcaaggtgcaattgagtat
ttgttaggaggtaattag

DBGET integrated database retrieval system