KEGG   Candida dubliniensis: CD36_25740Help
Entry
CD36_25740        CDS       T01140                                 

Definition
(RefSeq) acetyl-CoA carboxylase, putative
  KO
K11262  acetyl-CoA carboxylase / biotin carboxylase 1 [EC:6.4.1.2 6.3.4.14 2.1.3.15]
Organism
cdu  Candida dubliniensis
Pathway
cdu00061  Fatty acid biosynthesis
cdu00620  Pyruvate metabolism
cdu00640  Propanoate metabolism
cdu01100  Metabolic pathways
cdu01110  Biosynthesis of secondary metabolites
cdu01130  Biosynthesis of antibiotics
cdu01212  Fatty acid metabolism
Module
cdu_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CD36_25740
   00640 Propanoate metabolism
    CD36_25740
  Lipid metabolism
   00061 Fatty acid biosynthesis
    CD36_25740
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    CD36_25740
Enzymes [BR:cdu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     CD36_25740
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     CD36_25740
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     CD36_25740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACC_central Carboxyl_trans CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl ATPgrasp_Ter ATP-grasp_3 Biotin_lipoyl_2 Dala_Dala_lig_C GxGYxYP_N
Motif
Other DBs
NCBI-GeneID: 8050077
NCBI-ProteinID: XP_002421671
UniProt: B9WKR0
Position
R:165377..172063
Genome map
AA seq 2228 aa AA seqDB search
MSDQSPSPSPSPSDSLSYTTLHESLPPHFLGGNSVLNAEPSKVKDFVRAHQGHTVISKIL
IANNGIAAVKEIRSVRKWAYETFGDEKAIQFTVMATPEDLEANAEYIRMADQFIEVPGGT
NNNNYANVDLIVEIAESTNAHAVWAGWGHASENPLLPEKLAASPKKIIFIGPPGSAMRSL
GDKISSTIVAQHAQVPCIPWSGTGVDEVKIDPETNLVSVADDVYAKGCCTSPEDGLEKAK
KIGFPVMIKASEGGGGKGIRKVDDEKNFITLYNQAANEIPGSPIFIMKLAGDARHLEVQL
LADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIARKETFHEMENAAVRLGKLVGYVSAGT
VEYLYSHAEDKFYFLELNPRLQVEHPTTEMVTGVNLPAAQLQIAMGIPMHRIRDIRTLYG
ADPHTTTNIDFEFKSETSLVSQRRPTPKGHCTACRITSEDPGEGFKPSGGSLHELNFRSS
SNVWGYFSVGNQSSIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSIRGDFRTTVEYL
IKLLETPDFEDNTITTGWLDELITKKLTAERPDPIVAVVCGAVTKAHIQAEEEKNEYIQS
LEKGQVPHKNLLKTIFPVEFIYEGERYKFTATKSSEDKYTLFLNGSRCVVGARSLSDGGL
LCALDGKSHSVYWKEEASATRLSVDGKTCLLEVENDPTQLRTPSPGKLVKYLVDSGEHVD
AGQPYAEVEVMKMCMPLIAQENGVVQLIKQPGSTVNAGDILAILALDDPSKVKHAKPFEG
TLPAMGEPNVTGTKPAHKFHHYAGILKNILAGYDNQVILNSTLKSLGEVLKDKELPYSEW
QQHISALHSRLPPKLDDGLTALVERTQSRGAEFPARQILKLITKAIHENGNDMLEDVVAP
LVSIATSYQNGLIEHEYDYFASLISEYYDVESLFSGENVREDNVILKLRDENKSDLKKVI
GIGLSHSRVSAKNNLILAVLDIYEPLLQSNSSVAGSIREALKKLVQLDSRACAKVALKAR
EILIQCSLPSIKERSDQLEHILRSSVVQTSYGEIFAKHREPNLEIIREVVDSKHIVFDVL
SQFLINPDPWVAIAAAEVYVRRSYRAYDLGKIEYHVNDRLPIVEWKFKLASMGAAGVNDA
QQAAVAGGDDSTSMKHAASVSDLTFVVDSKTEHTTRTGVLAPARHLDDVDETLTAALEQF
QPADAISFKAKGEAPELLNVLNIVITSIDGYSNENEYLSRINEILCEYKEELISAGVRRV
TFVFAHQIGQYPKYYTFTGPDYEENKVIRHIEPALAFQLELGRLANFDIKPIFTNNRNIH
VYDAIGKNAPSDKRFFTRGIIRTGVLKEDISISEYLIAESNRLMNDILDTLEVIDTSNSD
LNHIFINFSNAFNVQASDVEAAFGSFLERFGRRLWRLRVTGAEIRIVCTDPQGTSFPLRA
IINNVSGYVVKSELYLEVKNPKGEWVFKSIGHPGSMHLRPISTPYPVKESLQPKRYKAHN
MGTTYVYDFPELFRQATISQWKKYGKKVPKDVFVSLELITDETDSLIAVERDPGANKIGM
VGFKVTAKTPEYPHGRQLIIVANDITHKIGSFGPEEDNYFNKCTELARKLGIPRIYLSAN
SGARIGVAEELIPLYQVAWNEEGSPDKGFRYLYLSTAGKESLEKDGKGGSVVTERIVENG
EERHVIKAIIGADDGLGVECLKGSGLIAGATSRAYKDIFTITLVTCRSVGIGAYLVRLGQ
RAIQIDGQPIILTGAPAINKLLGREVYSSNLQLGGTQIMYNNGVSHLTANDDLAGVEKIM
EWLSYVPAKRGLPVPILESEDSWDRDVDYYPPKQEAFDVRWMIQGREVDGEYESGLFDKD
SFQETLSGWAKGVVVGRARLGGIPIGVIGVETRTIENLIPADPANPDSTENLIQEAGQVW
YPNSAFKTAQAINDFNNGEQLPLMILANWRGFSGGQRDMYNEVLKYGSFIVDALVDFKQP
IFTYIPPNGELRGGSWVVVDPTINSDMMEMYADVDSRAGVLEPEGMVGIKYRRDKLLATM
ERLDPTYGDLKAKFNDSSLSPEEHSKVSAKLFAREKALLPIYAQISVQFADLHDRSGRML
AKGVIRKEIKWTDARRFFFWRLRRRLNEEYVLRLISEQIKDASKLERVARLKSWMPTVEY
DDDQAVSNWIEENHTKLQKRVNELKQEVSRTKIMRLLKEDPNSAISAMKDYVEGLSKEDK
EKFLKALK
NT seq 6687 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatcaatctccttctcctagccctagtcctagcgattcccttagttatactaca
ttacatgaaagcttaccacctcattttttgggtggaaactcagttttgaatgctgagcct
tctaaagttaaagactttgtcagagctcatcaaggtcatacagttatttctaagatttta
attgccaacaatggtatagctgcagttaaagaaattagatcagttagaaaatgggcttat
gaaacatttggtgatgaaaaagccatacagttcaccgttatggccactccagaggatttg
gaagctaatgccgaatacattagaatggccgaccaattcattgaagtccccggtggcacc
aataacaataactatgccaacgttgatctcattgtagagatagcagaaagcacaaatgct
catgctgtttgggctgggtggggacatgcttccgaaaaccctttgttgccagaaaaatta
gctgcctctcccaagaagattatttttattggacctcctgggtcagctatgagatcttta
ggtgataagatttcatctactatagttgctcaacatgcccaagtaccatgtattccatgg
tctggtactggtgttgatgaagtgaaaatagatccagaaactaatttggtttctgttgct
gatgatgtttatgccaaaggatgctgtactagtccagaagatggtttagaaaaagccaag
aaaattgggttcccagtcatgattaaagcttctgaaggtggtggtggtaaaggtattaga
aaagtcgatgatgagaagaatttcattaccttgtacaatcaagcagctaatgaaatacca
ggttctcctatttttatcatgaagttggctggtgatgccagacatttggaggttcaatta
ctagctgatcagtatggtaccaacatttcactttttggaagagattgttccgttcaaaga
agacatcaaaagattattgaagaggcaccagtcaccattgccagaaaggaaactttccac
gaaatggagaacgctgcagtcagattgggtaaattagttggttatgtatctgctggtacc
gttgaatatctttactcccatgctgaagacaaattttactttttggaattaaacccaaga
ttgcaagttgaacatccaaccactgaaatggtaacaggggtaaatttaccggctgctcaa
ttacaaattgctatgggtataccaatgcatcgaatcagagatatcagaactttgtatggt
gctgatccacataccacaactaatattgattttgaatttaaatcagagacctcattggtc
agtcaaagaagaccaacaccaaaggggcattgtactgcttgtcgtattacttctgaagac
ccaggtgaaggttttaaaccaagtggtggttctttacatgaattgaatttccggtcctct
tccaatgtgtggggttatttctcagtgggtaaccaatcttctatccattcattctcggat
tctcaatttggtcatatttttgcctttggtgaaaatcgtcaagcttcaagaaaacatatg
gttgttgctttgaaagaattaagtattagaggtgattttagaactacagttgaatattta
atcaaattgttagaaactccagatttcgaggataacaccattacaactggttggttagat
gaattaatcaccaagaagttgactgcagaaagaccagatccaatagttgctgttgtttgt
ggagctgtaactaaagctcatattcaggccgaggaagagaaaaacgagtacatccaatct
ttggaaaaaggtcaagttcctcacaagaatttattgaaaactattttccctgttgaattt
atttatgaaggtgaaagatacaagttcactgctaccaaatcctcagaagataaatatact
ttgttccttaatggttctcgttgtgttgttggtgcacgctcattgtcggatggtggttta
ttatgtgcattagacgggaaatcacattctgtgtactggaaagaagaggcatcagccact
agattatctgttgatggtaaaacttgtttattggaagttgaaaatgatccaacacaatta
agaactccatctccaggtaaattggtcaagtatttggttgacagtggtgaacatgttgat
gcaggtcagccatatgccgaggttgaagtgatgaaaatgtgtatgcctttgattgctcaa
gaaaatggggtggtacaattgattaaacaaccaggttcaacagttaatgctggtgacatc
ttggccattttggcattggatgatccatctaaggtcaagcatgctaaaccatttgaaggt
actttgccagccatgggtgagccaaatgttacaggtaccaagccagcacacaagttccat
cattatgctggtattttgaagaatatcttggcaggttatgataatcaagtgattttgaac
tctactttaaagagtcttggtgaagttttgaaagacaaggaattgccatactccgaatgg
caacagcacatttcagctttacattccagattgccacctaaattggatgatggattaact
gcattggtcgaaagaactcagagtagaggagctgaattccctgctcgtcaaattttaaaa
ctcatcaccaaagcaattcatgaaaatggtaatgatatgttagaggatgtggttgcacca
ttggtttcaattgccacaagttatcaaaatggtttgattgaacatgaatacgattacttt
gcatctttgattagcgaatattatgatgttgaaagcttattttctggtgaaaatgtcaga
gaagataatgttattttgaaattgagagatgaaaacaaatctgatttgaagaaagttatt
ggtattggtttgtctcattcacgtgttagtgccaaaaacaatttgatattggccgtttta
gacatatatgaaccattgttgcaatccaattcatccgttgctggttctattagagaagct
ttgaaaaaacttgttcaattggattctcgtgcttgtgctaaagttgcattaaaagccaga
gaaattttgatccaatgttcattaccttccatcaaggaaagatctgatcaattggaacat
attttgagatcatctgttgttcaaacctcgtatggtgaaatttttgctaaacatagagaa
ccaaatttggaaattattcgtgaagttgttgattccaaacacattgtttttgatgtgttg
tcacaatttttgatcaatccagatccatgggttgccattgctgcagctgaagtgtatgtc
agacgttcataccgtgcttatgatttgggtaaaattgaatatcatgttaacgacagactt
cctattgttgaatggaaattcaagttagctagtatgggagccgctggagtaaatgatgct
caacaggctgctgttgctggtggtgatgactcaacatcaatgaaacatgctgcttcagtt
tctgatttgacctttgttgttgattccaaaaccgagcatactacaagaactggtgtgtta
gctcccgcaagacacttggatgatgttgatgaaactctcacagctgcattggaacaattt
caaccagctgatgctatttcattcaaagcaaagggtgaagctccagaattattaaacgtt
ttgaacattgtcattactagcattgatggttattccaatgaaaatgaatacttgagcaga
attaatgaaatcttgtgtgagtacaaagaagagttgatatctgctggtgtacgtcgtgtt
acttttgttttcgcacatcaaattggtcaatatcctaaatactatacttttactggtcct
gattatgaagaaaataaagttattagacatattgaacctgctttagctttccaattggaa
ttgggaagattggccaatttcgacatcaagccaattttcactaacaacagaaatatccat
gtatatgatgcaattggtaaaaacgcaccttctgataagagatttttcaccagaggtatt
atcagaaccggtgttctcaaagaagacattagcattagtgaatacttgattgctgaatct
aatagattaatgaatgatattttggatacattggaagtcattgatacttctaattctgat
ttgaatcacattttcattaatttttcaaatgctttcaatgttcaagcatcagatgttgag
gctgcctttggatcatttttagaaagatttggtagaagattatggagattaagagttact
ggtgccgagattagaattgtttgtactgatcctcaaggtacttctttcccattacgtgct
atcattaataatgtctctggttatgttgtgaaatcagaattgtatttggaagttaaaaac
cctaaaggtgaatgggttttcaaatccattggtcatccaggttccatgcatttgagacct
atctcgactccatatccagtcaaagaatctttgcaacctaaacgttacaaagctcacaat
atgggtactacatatgtctatgatttcccagaattattccgtcaagcgactatttcacaa
tggaaaaaatatggtaagaaagtaccaaaagacgtttttgtatctttagagttgatcact
gatgaaactgattccttgatagctgttgaaagagacccaggtgcaaataaaattgggatg
gttggattcaaagtcactgctaaaacccctgaataccctcatggtcgtcaattaattatt
gttgccaatgatattactcacaagattggttcatttggtccagaagaagataattacttc
aacaagtgtactgaattggcaaggaaattgggtattccaagaatttacctttctgcaaac
tcaggtgctagaattggtgttgctgaagaattgattccattataccaagttgcctggaat
gaagaagggtctcctgacaagggatttagatacttgtatttgagcactgctggtaaagag
tctttagagaaagatggcaaaggtggcagtgttgttactgaacgtattgttgaaaacggt
gaagagcgtcatgttattaaagctattattggtgctgatgatggtttaggggttgaatgt
cttaaaggatctggtttgattgctggtgccacttcaagggcttacaaagatatattcact
atcactttggtaacttgtagatccgttggtattggtgcatacttggttagattgggtcaa
agagcaattcaaatcgacggtcaacctattattttaactggggctcctgctatcaataaa
ttattgggtagagaagtgtattcctcaaatcttcaattgggaggtactcaaattatgtat
aataatggtgtttctcatttgactgctaatgatgatttggctggggttgaaaagattatg
gaatggttatcgtatgttccagctaagcgtggcttgccagttccaattttggaatcagaa
gactcttgggatagagatgttgattactatccaccaaaacaggaagcctttgatgttaga
tggatgattcaaggtagagaagtcgatggtgaatatgaatctgggttatttgataaagac
tcattccaagaaacattgtctggttgggctaaaggtgttgttgttggtagggcacgtttg
ggtggtattccaattggtgtgattggtgtcgaaacaagaacaatagaaaacttgattcct
gccgatccagcaaatccagattctacagaaaatttgatccaagaagctggtcaagtgtgg
tatcctaactctgctttcaagacagcacaagctataaatgatttcaacaatggtgaacaa
ttgccattaatgattttagcaaattggagaggtttttccggtggtcaaagagacatgtac
aatgaagtcttgaaatatggttcatttattgttgacgctttggttgatttcaaacaacct
attttcacttatattccaccaaatggagaattgagaggtggttcatgggttgttgttgat
ccaactattaactcagatatgatggaaatgtatgctgatgtcgattcaagagctggtgtt
ttggaaccagaaggtatggttggtatcaaatatagacgtgataaattattggcaactatg
gaaagattggacccaacttacggtgacttgaaagccaagtttaacgattcatcgttgtct
ccagaagaacattcgaaagtaagtgctaaattgtttgctcgtgaaaaggctttgttacca
atttatgctcaaatttctgttcaatttgctgacttgcacgatagatctggtcgtatgttg
gccaagggagttattagaaaggaaatcaaatggactgatgctagacgtttcttcttctgg
agattaagaagaagattgaatgaagaatatgttttgagattgatcagtgaacaaatcaaa
gatgctagcaagttggaaagagttgctagattaaagagttggatgccaactgttgaatac
gatgatgatcaagctgtcagtaattggattgaagagaaccatacaaaattacaaaagagg
gttaatgaattgaaacaagaagtttcaagaaccaagattatgagattattaaaagaggat
ccaaatagtgcaatctctgccatgaaggattatgttgaagggttatccaaagaagataaa
gagaaattcctcaaggcattaaagtag

DBGET integrated database retrieval system