KEGG   Candida dubliniensis: CD36_27000Help
Entry
CD36_27000        CDS       T01140                                 

Definition
(RefSeq) NADP-dependent alcohol dehydrogenase, putative
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cdu  Candida dubliniensis
Pathway
cdu00010  Glycolysis / Gluconeogenesis
cdu00071  Fatty acid degradation
cdu00350  Tyrosine metabolism
cdu01100  Metabolic pathways
cdu01110  Biosynthesis of secondary metabolites
cdu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CD36_27000
  Lipid metabolism
   00071 Fatty acid degradation
    CD36_27000
  Amino acid metabolism
   00350 Tyrosine metabolism
    CD36_27000
Enzymes [BR:cdu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CD36_27000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C ADH_zinc_N_2 2-Hacid_dh_C Pyr_redox 3HCDH_N NAD_binding_7 Pyr_redox_2 XdhC_C TrkA_N
Motif
Other DBs
NCBI-GeneID: 8049880
NCBI-ProteinID: XP_002421782
UniProt: B9WL21
Position
R:complement(440814..441893)
Genome map
AA seq 359 aa AA seqDB search
MSLLLKRLSPIKQSYSKALAIRTMSIPSTQYGFFYNKSSGLNLKKDLPVNKPGAGQLLLK
VDAVGLCHSDLHVLYEGLDCGDNYVMGHEIAGTVAELGEEVSEFSVGDRVACVGPNGCGL
CKHCLTGNDNVCTKSFLDWFGLGYNGGYEQFLLVKRPRNLVKIPDNVTSEEAAAITDAVL
TPYHAIKSAGVGPASNILIIGAGGLGGNAIQVAKAFGAKVTVLDKKDKARDEAKAFGADQ
VYSELPESVLPGSFSACFDFVSVQATYDLCQTYCEPKGTIVPVGLGASSLNINLADLDLR
EITVKGSFWGTSMDLREAFELAAQGKVKPKVAHAPLTELPKYLEKLRAGGYEGRVVFNP
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgtcacttcttttgaaacgattaagtccaattaaacaatcttattctaaagcacttgca
atacgcacaatgtcaattccttcaacgcagtacggatttttttataataaatccagtggt
cttaacttgaaaaaagacttgccggttaacaagccaggtgctggtcaattgcttttgaaa
gttgatgcagtcggtctttgtcattcagatttacatgttctttatgaaggtttggattgt
ggtgacaattatgtgatgggccatgaaattgctgggactgttgctgaactaggtgaagaa
gtgagtgaattttctgttggagatcgtgttgcttgtgttggtcccaatggttgtggtctt
tgtaaacattgtcttactggtaacgataatgtctgtaccaagtcttttttggactggttc
ggtttgggttacaatggtggttacgagcaatttttgttggtcaaaagaccaagaaatttg
gttaaaatccccgacaatgttacttctgaagaagcggcagctattactgatgctgtgttg
actccttaccatgccatcaagtctgccggtgttggtccagcaagcaatatattaattatc
ggagctggtgggttaggaggcaatgctattcaagttgcaaaagcatttggtgccaaagtt
actgttttggataaaaaggacaaggcaagagacgaagccaaagcctttggagctgaccag
gtttacagcgagttacccgagagcgttttgcctggatcatttagtgcttgttttgatttt
gtttctgtccaggcaacatatgatttgtgccaaacgtattgtgaaccaaagggtactatt
gttcccgtaggtttgggtgcatcttcactcaatatcaatcttgctgatttagatcttcgt
gaaattactgtcaagggctcattctggggtactctgatggatttaagagaagcatttgaa
ttggcagcacagggaaaagtcaaaccaaaagttgctcatgctccattgacagaattaccc
aagtatttggagaagttgagagccggtggttacgaaggaagagttgtatttaatccataa

DBGET integrated database retrieval system